PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g52410.1
Common NameMADS31, Os04g0614100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 179aa    MW: 21254.9 Da    PI: 10.2113
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g52410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.6e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+ien +nrqvtfskRr g+lKKA+EL +LCda++ vi+fs tgk+yeyss
  LOC_Os04g52410.1  9 KKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIVFSGTGKMYEYSS 59
                      68***********************************************96 PP

2K-box55.82e-19851541483
             K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                       +++  qe++++k+e++ L+   R+++G+dL sL+l++  +Leqq+e sl k+R +K++ll +q+ e+  +
  LOC_Os04g52410.1  85 QQRIIQEMTRMKDENNRLRIIMRQYMGDDLASLTLQDVSNLEQQIEFSLYKVRLRKQQLLDQQLLEMHSR 154
                       67889**********************************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.23161IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-30280IPR002100Transcription factor, MADS-box
CDDcd002653.08E-36276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-1681154IPR002487Transcription factor, K-box
PROSITE profilePS5129712.09985178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001012developmental stageG early unicellular microspore stage
PO:0001013developmental stageH late unicellular microspore stage
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGRGRVELKK IENPTNRQVT FSKRRMGLLK KANELAILCD AQIGVIVFSG TGKMYEYSSP  60
PWRIANIFDR YLKAPSTRFE EMDVQQRIIQ EMTRMKDENN RLRIIMRQYM GDDLASLTLQ  120
DVSNLEQQIE FSLYKVRLRK QQLLDQQLLE MHSRVCNKRI YRFSILPYLI HYIEIIKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-16260159Myocyte-specific enhancer factor 2A
3mu6_C6e-16260159Myocyte-specific enhancer factor 2A
3mu6_B6e-16260159Myocyte-specific enhancer factor 2A
3mu6_A6e-16260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84NC2
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g52410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g52410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1776980.0AY177698.1 Oryza sativa (japonica cultivar-group) transcription factor MADS31 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635709.11e-109PREDICTED: MADS-box transcription factor 31-like isoform X5
SwissprotQ84NC21e-132MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLI1PPV41e-129I1PPV4_ORYGL; Uncharacterized protein
STRINGORGLA04G0222300.11e-128(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.32e-41MIKC_MADS family protein
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]