PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g51190.2
Common NameGRF3, LOC4336879, Os04g0600900, OsJ_16036, OSJNBa0083N12.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 388aa    MW: 41618.5 Da    PI: 7.6013
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g51190.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.28e-25114158145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  LOC_Os04g51190.2 114 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVEA 158
                       79****************************************996 PP

2QLQ591.4e-205388237
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      +FTaaQ ++L++Q+l+yKyL+a++PvP++Ll++i++
  LOC_Os04g51190.2 53 PFTAAQYEELEQQALIYKYLVAGVPVPADLLLPIRR 88
                      9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-115288IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1875388IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-145387IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.517114158IPR014977WRC domain
PfamPF088794.0E-21115157IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSFIF PFCRSSPLSA VGEEAQQHMM GARWAAAVAR PPPFTAAQYE  60
ELEQQALIYK YLVAGVPVPA DLLLPIRRGL DSLASRFYHH PVLGYGSYFG KKLDPEPGRC  120
RRTDGKKWRC SKEAAPDSKY CERHMHRGRN RSRKPVEAQL VAPHSQPPAT APAAAVTSTA  180
FQNHSLYPAI ANGGGANGGG GGGGGGGSAP GSFALGSNTQ LHMDNAASYS TVAAGAGNKD  240
FRYSAYGVRP LADEHSPLIT GAMDTSIDNS WCLLPSQTST FSVSSYPMLG NLSELDQNTI  300
CSLPKVEREP LSFFGSDYVT VDSGKQENQT LRPFFDEWPK ARDSWPDLAD DNSLATFSAT  360
QLSISIPMAT SDFSTTSSRS HNGIYSR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.594250.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6AWY6
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g51190.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g51190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5466930.0FJ546693.1 Oryza sativa Indica Group cultivar IR58 growth-regulating factor 3 (GRF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634333.10.0PREDICTED: growth-regulating factor 3 isoform X2
RefseqXP_015634332.10.0PREDICTED: growth-regulating factor 3 isoform X1
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLB8ATM90.0B8ATM9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA014417-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g51190.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-47growth-regulating factor 5
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]