PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g51000.1
Common NameFL, LOC4336857, Os04g0598300, OsJ_16017, OSJNba0093F12.17, OSL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LFY
Protein Properties Length: 390aa    MW: 42530.3 Da    PI: 8.4779
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g51000.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY544.14.8e-16613781386
           FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmk 91 
                       mdp++ fsa+  f+wd  +    +pa + +    ++          a+  releel+ +yGvr++tva+i+elGft+stL+ m+++eldd+m+
  LOC_Os04g51000.1   1 MDPNDaFSAAhPFRWDLGPP---APAPVPPPPPPPP------PPPPANVPRELEELVAGYGVRMSTVARISELGFTASTLLAMTERELDDMMA 84 
                       777654776559****5322...2223322222222......234566789****************************************** PP

           FLO_LFY  92 slseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseee 184
                       +l+ +fr+dll+Ger+G++aa+raer rl++     +++    +++ +++d +sqe+ls+e++     +agsgg+g  +++  +++ kk+ ++
  LOC_Os04g51000.1  85 ALAGLFRWDLLLGERFGLRAALRAERGRLMSLG--GRHH---GHQSGSTVDGASQEVLSDEHD-----MAGSGGMGDDDNGRRMVTGKKQAKK 167
                       ******************************965..5555...6788889***********976.....6788888888888877777666666 PP

           FLO_LFY 185 kkkaskk.kqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqk 268
                        + a+k  k++rkk ++l+ + +ede +  ded+ g        +g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+
  LOC_Os04g51000.1 168 GSAARKGkKARRKKVDDLRLDMQEDEMDCCDEDGGGgsestessAGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQVQS 260
                       66555543667777777666644444443333333334455554888899******************************************* PP

           FLO_LFY 269 iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfna 361
                       +ak +G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeas+alrra+k+rgenvGawrqacy+plv+i+ar+g+didavf+a
  LOC_Os04g51000.1 261 MAKLHGHKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASDALRRAYKARGENVGAWRQACYAPLVDISARHGFDIDAVFAA 353
                       ********************************************************************************************* PP

           FLO_LFY 362 hprLsiWYvPtkLrqLChlerskas 386
                       hprL+iWYvPt+LrqLCh++rs+++
  LOC_Os04g51000.1 354 HPRLAIWYVPTRLRQLCHQARSSHA 378
                       **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1911378IPR002910Floricaula/leafy protein
SuperFamilySSF1014474.18E-62737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP APAPVPPPPP PPPPPPPANV PRELEELVAG YGVRMSTVAR  60
ISELGFTAST LLAMTERELD DMMAALAGLF RWDLLLGERF GLRAALRAER GRLMSLGGRH  120
HGHQSGSTVD GASQEVLSDE HDMAGSGGMG DDDNGRRMVT GKKQAKKGSA ARKGKKARRK  180
KVDDLRLDMQ EDEMDCCDED GGGGSESTES SAGGGGGERQ REHPFVVTEP GEVARAKKNG  240
LDYLFHLYEQ CRLFLLQVQS MAKLHGHKSP TKVTNQVFRY AKKVGASYIN KPKMRHYVHC  300
YALHCLDEEA SDALRRAYKA RGENVGAWRQ ACYAPLVDIS ARHGFDIDAV FAAHPRLAIW  360
YVPTRLRQLC HQARSSHAAA AAALPPPLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A5e-992163842170PROTEIN LEAFY
2vy1_A5e-992163842170PROTEIN LEAFY
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO22747890.0
Expression AtlasQ0JAI1-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In very young panicle but not in mature florets, mature leaves, roots or apical meristems.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g51000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g51000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0056200.0AB005620.1 Oryza sativa mRNA for RFL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635355.10.0PREDICTED: probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A0D9ZQ440.0A0A0D9ZQ44_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0DHU90.0A0A0E0DHU9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PDJ30.0A0A0E0PDJ3_ORYRU; Uncharacterized protein
STRINGBGIOSGA014428-PA0.0(Oryza sativa Indica Group)
STRINGORGLA04G0204600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70181619
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-97floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Gong P,Zhao M,He C
    Slow co-evolution of the MAGO and Y14 protein families is required for the maintenance of their obligate heterodimerization mode.
    PLoS ONE, 2014. 9(1): p. e84842
    [PMID:24416299]
  2. Kyozuka J,Konishi S,Nemoto K,Izawa T,Shimamoto K
    Down-regulation of RFL, the FLO/LFY homolog of rice, accompanied with panicle branch initiation.
    Proc. Natl. Acad. Sci. U.S.A., 1998. 95(5): p. 1979-82
    [PMID:9482818]