PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g50770.1
Common NameLOC4336841, Os04g0594100, OSJNBa0009P12.32, OSNPB_040594100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 372aa    MW: 39768.5 Da    PI: 4.6807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g50770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-171663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +++++G  +W++ ++  g+ R++k+c++rw +yl
  LOC_Os04g50770.1 16 KGSWTPEEDMRLVAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                      799*****************************99************97 PP

2Myb_DNA-binding537.6e-1769114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  LOC_Os04g50770.1  69 RGNFTAEEEETIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.031163IPR017930Myb domain
SuperFamilySSF466891.5E-3013110IPR009057Homeodomain-like
SMARTSM007174.0E-131565IPR001005SANT/Myb domain
PfamPF002493.8E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-241770IPR009057Homeodomain-like
CDDcd001671.70E-101863No hitNo description
PROSITE profilePS5129424.66264118IPR017930Myb domain
SMARTSM007176.3E-1568116IPR001005SANT/Myb domain
PfamPF002496.3E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2671117IPR009057Homeodomain-like
CDDcd001675.39E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLVAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEETI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSP  120
EQKKGGGKSK KKTTCTDVLV PSPSPSSSTT TTTNCSSGDS AGEQSNTSKE EEEETDKIEI  180
PMLELDPCCF DFDMLVDPVV PDTYCPAVSA SASASAPTSP CSSTSPSCAR AGVDPLLDLP  240
EIVDLGPELW SIMDGGAGDG CTEAPPPAWS NAAAAAAANA TVATTTSLEE EEGKEWWLED  300
LEKELGLWGP TDDYHCHPGP QGQPGRAGPP PSAVVEDPVS CYFQAGPTAA ATWQGHEPSA  360
VITSNPMDYY V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281411825128MYB TRANSFORMING PROTEIN
1mse_C3e-28141182105C-Myb DNA-Binding Domain
1msf_C3e-28141182105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.313810.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379886230.0
Expression AtlasQ0JAJ7-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g50770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g50770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119600.0AK111960.1 Oryza sativa Japonica Group cDNA clone:001-031-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635813.10.0PREDICTED: myb-related protein Zm1
SwissprotP200241e-106MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0E0PDG20.0A0A0E0PDG2_ORYRU; Uncharacterized protein
TrEMBLQ0JAJ70.0Q0JAJ7_ORYSJ;
TrEMBLQ7X7930.0Q7X793_ORYSA;
STRINGLOC_Os04g50770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.14e-69myb domain protein 63