PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g49450.1
Common NameLOC4336779, Os04g0583900, OSJNBa0088A01.20, OSNPB_040583900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 464aa    MW: 51100.6 Da    PI: 5.8676
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g49450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-1659103147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r +WT++E++l+++a +++G   W++I +++g ++t+ q++s+ qk+
  LOC_Os04g49450.1  59 REKWTEDEHKLFLEALQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 103
                       789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-1553106IPR009057Homeodomain-like
PROSITE profilePS5129420.31854108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-956110IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1557106IPR006447Myb domain, plants
SMARTSM007173.8E-1358106IPR001005SANT/Myb domain
PfamPF002491.9E-1459102IPR001005SANT/Myb domain
CDDcd001673.52E-1061104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MARFQETKAR NDQGPVADHV GHQNLMENLT DPLDSSGMDM MDEARIPKAR KPYTITKQRE  60
KWTEDEHKLF LEALQLHGRA WRRIQEHIGT KTAVQIRSHA QKFFSKVIKE SSGDNCNSLG  120
AASSIQIPPP RPKRKPVHPY PRNLGSTASK NVPALKQLEK PQLQVQSLYD QDNGSPTSVL  180
TVPQIRADTL GSESGGSPTS TIDIEERCPT PSIATAELAM ELPPTNDEEV KGNGDHEEVT  240
CDRSGVPVLR LFGKRVMVND LHQMSAPDAG NLQTVADMEV DASAETPTSG TGKFSSHGAA  300
EANTWNPWLT NTQQFLYYLP NGQIFSVHSA LPCFTYHNEG VTCTQFSNPQ VVASDQQHQH  360
QTSEAVDYKG IQREGSWTES NTSSSSVPET ATHNSETTES YRNGNRNEDE MVPSPDSRKC  420
VSPGSNCRRG FVPYKRCVAD SEALLKSQAP QEEADGEMTR LCL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.53350.0callus| leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329864180.0
Expression AtlasQ7XUC8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g49450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g49450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1012090.0AK101209.1 Oryza sativa Japonica Group cDNA clone:J033031A06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636284.10.0PREDICTED: uncharacterized protein LOC4336779
TrEMBLQ7XUC80.0Q7XUC8_ORYSJ;
STRINGLOC_Os04g49450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12551549
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.12e-35MYB_related family protein