PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g49110.1
Common NameLOC4336759, Os04g0580300, OsJ_15890, OSJNBa0064M23.7, OSNPB_040580300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 620aa    MW: 64918.2 Da    PI: 7.5717
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g49110.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS283.65.6e-872626192374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL e+A a+++g++e a + L+ l+  a+++gd  qRl+a+++ AL++r+ +       + ++ +       e+ a  +l++++sP+++++
  LOC_Os04g49110.1 262 RQLLSEAAAAIADGHNETAATHLTALKRAANSRGDVEQRLVAMMVAALSSRIGQ-------TASVPDI---CGGETRAGSQLLHDISPCFRLA 344
                       689**************************************************9.......1111122...24455566789*********** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                         +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ +  sl++T+v +p+s  ++++ +t   L+k+Ae+ g++ +f++ v+ r  
  LOC_Os04g49110.1 345 LHAANVAIVDAVGDHRAIHLVDFDVSAP-QHADLIRCLAARRLPGTSLKVTAVTDPASPFTQSVTAT-LHLQKLAERAGIDYRFKM-VSCRAG 434
                       *************************987.99************************987666666555.57***************9.7999** PP

              GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                       ++e ++L ++ gEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++ +rf++a+ +y a+++sl+a++pres 
  LOC_Os04g49110.1 435 EIEASKLGCEAGEALAVNLAFALSHVPDESVSPANPRDEILRRVRALGPQVVALVEQELNSNTAPLTTRFTDACAHYGAILESLDATIPRESA 527
                       ********************************************************************************************* PP

              GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er+  E++ lg ++ n+va ega+r er+e ++kWr+r+++aGF+pv+l+  +a+q+ +    v+  g+ v+ e+g l lgW++r ++++SaW
  LOC_Os04g49110.1 528 ERARAEAA-LGGRAANAVAREGADRLERCEVFGKWRSRFGMAGFRPVALGPGIADQVLARQGPVA-AGFAVKAENGVLRLGWMGRVVTVASAW 618
                       *******9.9999*******************************************977777777.99************************* PP

              GRAS 374 r 374
                       r
  LOC_Os04g49110.1 619 R 619
                       8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.155235600IPR005202Transcription factor GRAS
PfamPF035141.9E-84262619IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYLYGVGS AVQMPMQQRS DAAAAGGVLK RSLGDMERWQ QHQHQQRQIA  60
MQQQLYLRTV RQRTAAASAA VSPLTSADIA AVLGGPPSQP LVLSGSSMGG AFGSPSSTLS  120
SITTASRAVA MPLMQPQLQR QQQVTYMASS PQVQAFGTAR ALPPAPATSD LSILQELEKQ  180
LLGDDDEVEA AMSGTGSAVT GSEWEEQLNS ITAAPSPPLT AATTPNNNNN AVGMTRSPSN  240
SSTSTASSSA SCSPPTSATT SRQLLSEAAA AIADGHNETA ATHLTALKRA ANSRGDVEQR  300
LVAMMVAALS SRIGQTASVP DICGGETRAG SQLLHDISPC FRLALHAANV AIVDAVGDHR  360
AIHLVDFDVS APQHADLIRC LAARRLPGTS LKVTAVTDPA SPFTQSVTAT LHLQKLAERA  420
GIDYRFKMVS CRAGEIEASK LGCEAGEALA VNLAFALSHV PDESVSPANP RDEILRRVRA  480
LGPQVVALVE QELNSNTAPL TTRFTDACAH YGAILESLDA TIPRESAERA RAEAALGGRA  540
ANAVAREGAD RLERCEVFGK WRSRFGMAGF RPVALGPGIA DQVLARQGPV AAGFAVKAEN  600
GVLRLGWMGR VVTVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-342576191375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.118430.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329855030.0
Expression AtlasQ7X7C0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g49110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g49110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0H5150.0A0A0E0H515_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PD450.0A0A0E0PD45_ORYRU; Uncharacterized protein
TrEMBLA2XWQ90.0A2XWQ9_ORYSI; Putative uncharacterized protein
TrEMBLI1PP580.0I1PP58_ORYGL; Uncharacterized protein
TrEMBLQ7X7C00.0Q7X7C0_ORYSJ;
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-88SCARECROW-like 8