PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g48510.1
Common NameGRF12, LOC4336731, Os04g0574500, OsJ_15856, OSJNBa0019K04.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 237aa    MW: 24970.6 Da    PI: 10.24
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g48510.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.92.3e-25140184145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  LOC_Os04g48510.1 140 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPMEA 184
                       69***************************************9987 PP

2QLQ54.24.5e-1973109137
               QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  LOC_Os04g48510.1  73 SALTFMQRQELEQQVLIYRYFAAGAPVPVHLVLPIWK 109
                       799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.1E-673109IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-1174108IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.21774109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072140184IPR014977WRC domain
PfamPF088799.3E-21141182IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MLAEGRQVYL PPPPPSKLPR LSGTDPTDGV VTMAAPSPLV LGLGLGLGGS GSDSSGSDAE  60
ASAATVREAR PPSALTFMQR QELEQQVLIY RYFAAGAPVP VHLVLPIWKS IAAASSFGPQ  120
SFPSLTGLGS LCFDYRSSME PEPGRCRRTD GKKWRCSRDV VPGHKYCERH VHRGRGRSRK  180
PMEASAAVAP TYLPVRPALH TVATLATSAP SLSHLGFSSA SKVLLAHTTT GTTRAT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181GRGRSRKPM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.571110.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329961430.0
Expression AtlasQ6AWX7-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g48510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g48510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1109340.0AK110934.1 Oryza sativa Japonica Group cDNA clone:002-173-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635359.11e-170PREDICTED: growth-regulating factor 12
SwissprotQ6AWX71e-172GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLA0A0E0PCZ41e-170A0A0E0PCZ4_ORYRU; Uncharacterized protein
STRINGLOC_Os04g48510.11e-169(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.12e-37growth-regulating factor 3
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]