PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g48070.2
Common NameGL2-4, LOC4336705, Os04g0569100, OSJNBb0032E06.7, ROC4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 807aa    MW: 86004.2 Da    PI: 5.8362
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g48070.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.91.5e-22105160156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
  LOC_Os04g48070.2 105 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMK 160
                       688999***********************************************998 PP

2START161.46.9e-513165492206
                       HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S... CS
             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla... 77 
                       la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d + +W+ ++    
  LOC_Os04g48070.2 316 LAMSAMDELVKMAQMGDPLWIPGAsvpsspakESLNFEEYLNTFPPCIGvkpegYVSEASRESGIVIIDdGAALVETLMDER-RWSDMFScmi 407
                       67899***************9766667999****************9999**************998651558*********.********** PP

                       .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEE CS
             START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepk 157
                        ka+t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg++++++
  LOC_Os04g48070.2 408 aKASTTEEISTGvagsrnGALLLMQAELQVLSPLVPiREVKFLRFSKQLADGVWAVVDVSADELMRDQGitsasSTANMNCRRLPSGCVLQDT 500
                       *************************************************************9987666666454555689************* PP

                       CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       +ng  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
  LOC_Os04g48070.2 501 PNGFVKVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWIATLQRQCEC 549
                       ***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-2289160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-2491162IPR009057Homeodomain-like
PROSITE profilePS5007118.366102162IPR001356Homeobox domain
SMARTSM003893.2E-20103166IPR001356Homeobox domain
CDDcd000861.11E-20104160No hitNo description
PfamPF000467.4E-20105160IPR001356Homeobox domain
PRINTSPR000318.6E-5133142IPR000047Helix-turn-helix motif
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PRINTSPR000318.6E-5142158IPR000047Helix-turn-helix motif
PROSITE profilePS5084842.736306552IPR002913START domain
SuperFamilySSF559616.87E-25309549No hitNo description
CDDcd088751.04E-105310548No hitNo description
SMARTSM002344.4E-40315549IPR002913START domain
PfamPF018521.4E-42316549IPR002913START domain
SuperFamilySSF559613.71E-17569771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MQFPFSGAGP GVFTSSPALS LALADAVAGR NSGGGGKMVT AAHGGVGGGG GGGRAKARDA  60
LEVENEMSRS GSDHLDVVSC GDAGGGGGDD DDDEDAEHGN PPKRKKRYHR HTPQQIQELE  120
AMFKECPHPD EKQRAELSKR LGLEPRQVKF WFQNRRTQMK MQLERHENSL LKQENDKLRS  180
ENLSIREATS NAVCVGCGGP AMLGEVSLEE HHLRVENARL KDELSRVCAL AAKFLGKSIS  240
VMAPPQMHQP HPVPGSSLEL AVGGIGSMPS ATMPISTITD FAGAMSSSMG TVITPMKSEA  300
EPSAMAGIDK SLFLELAMSA MDELVKMAQM GDPLWIPGAS VPSSPAKESL NFEEYLNTFP  360
PCIGVKPEGY VSEASRESGI VIIDDGAALV ETLMDERRWS DMFSCMIAKA STTEEISTGV  420
AGSRNGALLL MQAELQVLSP LVPIREVKFL RFSKQLADGV WAVVDVSADE LMRDQGITSA  480
SSTANMNCRR LPSGCVLQDT PNGFVKVTWV EHTEYDEASV HPLYRPLLRS GLALGAGRWI  540
ATLQRQCECL ALLMSSIALP ENDSSAIHPE GKRSMLKLAR RMTDNFCAGV STSSTREWSK  600
LVGLTGNIGE DVHVMARKSV DEPGTPPGVV LSAATSVWMP VMPERLFNFL HNKGLRAEWD  660
ILSNGGPMQE VTSIAKGQQN GNTVCLLKAS PTKDKQNSML ILQETCADAS GSMVVYAPVD  720
IPAMHLVMSG GDSSCVALLP SGFAILPAGP SIGADHKMGG SLLTVAFQIL ANSQPSAKLT  780
VESVETVSNL ISCTIKKIKT ALHCDV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.88330.0callus| flower| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379887620.0
Expression AtlasQ7Y0V9-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g48070.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g48070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLQ01JP10.0Q01JP1_ORYSA;
STRINGLOC_Os04g48070.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein