PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g47990.2
Common NameLOC9267486, Os04g0567800, OSNPB_040567800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 364aa    MW: 35957.8 Da    PI: 8.6707
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g47990.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3959120263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  LOC_Os04g47990.2  59 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 120
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3155117IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3361117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05963117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MEEMLMAANA AAGANPNPAA TAPSSVTGGA LRGGGGGGAP PVAGGAGAGS TERRARPQKE  60
KALNCPRCNS TNTKFCYYNN YSLQQPRYFC KTCRRYWTEG GSLRNVPVGG GSRKNKRSSS  120
SAASASPASA STANSVVTSA SMSMSMASTG GGASKNPKLV HEGAQDLNLA FPHHGGLQAP  180
GEFPAFPSLE SSSVCNPGGP MGTNGRGGGA LSAMELLRST GCYMPLQVPM QMPAEYATPG  240
FALGEFRAPP PPPQSSQSLL GFSLDAHGSV GGPSAAGFGS SAGLQGVPES TGRLLFPFED  300
LKPTVSSGTG GGGASGGGAG VDGGHQFDHG KEQQAGGGGG GPGGHDTPGF WNGMIGGGSG  360
TSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41820.0flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO49966390.0
Expression AtlasA0A0P0WDP6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g47990.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g47990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAB0281290.0AB028129.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-18.
GenBankAL6629540.0AL662954.2 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0005N02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637009.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X2
TrEMBLA0A0E0H4I60.0A0A0E0H4I6_ORYNI; Uncharacterized protein
TrEMBLA0A0P0WDP60.0A0A0P0WDP6_ORYSJ; Os04g0567800 protein
STRINGBGIOSGA014530-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g47990.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-42Dof family protein