PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g47640.1
Common NameLOC4336672, Os04g0564000, OSJNBa0017B10.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 340aa    MW: 38758 Da    PI: 8.4571
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g47640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK825.9e-26200249352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i+l d+++yF+lpi++A+++L++++++LKr+CRqy+I+RWPhRkiksl
  LOC_Os04g47640.1 200 ASITLVDIAQYFHLPIREASRTLKIGVSILKRKCRQYNIPRWPHRKIKSL 249
                       78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.27184269IPR003035RWP-RK domain
PfamPF020424.3E-21201249IPR003035RWP-RK domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDAAAAAVST LSALAVFAST LDHGAVRSVH GYKVYGRGGR RRWERWVERE FVLTPASCRE  60
VPAPVAPPRI LPAEWRGRPA YREGQVVAAG AWRCILAFDS AAAPPRTPPP VLSPFLNPRL  120
MCVPSLYNDL EKVFRFQNVE KIPKLMQCDS EEKLSSWDAR DKSSDEVHAS ESDSDDDLQS  180
GEEEKPTVQK QRRANKKHIA SITLVDIAQY FHLPIREASR TLKIGVSILK RKCRQYNIPR  240
WPHRKIKSLD SLIQDLEYVI DDGDDHDDTG DDVQQEKHKQ TAEEKQEAIM ALTRRKQMLE  300
TEKETIQQIP AMDLKVETKQ FREDVFKRRY RAKKDLAND*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1327334RRYRAKKD
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976031790.0
Expression AtlasQ7XQK5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g47640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g47640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126121e-154CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankAP0149601e-154AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066281e-154AL606628.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0017B10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634161.10.0PREDICTED: protein RKD5 isoform X1
TrEMBLA0A0D3FYZ30.0A0A0D3FYZ3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H4E50.0A0A0E0H4E5_ORYNI; Uncharacterized protein
TrEMBLI1PNW30.0I1PNW3_ORYGL; Uncharacterized protein
TrEMBLQ01KH30.0Q01KH3_ORYSA; H0409D10.6 protein
TrEMBLQ7XQK50.0Q7XQK5_ORYSJ;
STRINGLOC_Os04g47640.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0188200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5671777
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-45RWP-RK domain-containing protein