PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g46580.1
Common NameLOC4336597, Os04g0551500, OSJNBa0010H02.3, OSJNBb0034G17.20, SPL7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 361aa    MW: 37387.1 Da    PI: 9.5399
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g46580.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40107183177
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       +CqvegC+  l+ +keyhrrhkvCevh+kap v+v+g+eqrfCqqCsrfh l efD++k+sCrrrLa+hnerrr+++
  LOC_Os04g46580.1 107 RCQVEGCDITLQGVKEYHRRHKVCEVHAKAPRVVVHGTEQRFCQQCSRFHVLAEFDDAKKSCRRRLAGHNERRRRSN 183
                       6*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.693105182IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.9E-34105169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.24E-39106185IPR004333Transcription factor, SBP-box
PfamPF031103.3E-32108181IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEGNGCGGSG ATPRGVVGMH WAPVVTSPPS PQPPFLPPAP CRPDVQMQQQ GGLTCLKLGK  60
RPCFWGGDGA GQVAQGSGGG GGGGGGGSAD QGKRKEKAAT AVPVVPRCQV EGCDITLQGV  120
KEYHRRHKVC EVHAKAPRVV VHGTEQRFCQ QCSRFHVLAE FDDAKKSCRR RLAGHNERRR  180
RSNASEAMAR GSAHPHGMPV LGHGFPPYGL PTSSAGALSL LSSARATGPW LMPTPDISAR  240
SSAALDELIA ENRAALLSWQ FFSDRQPPPA GRPTGRSPGS ETAGGWHAHL QARPPPPGAG  300
GQHENQSGHV TLDLMQATTA AGGSGAPFRP VPARPPKEGG DAGCTSDAWT PSPMEGARVV  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-311081811184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17687SGGGGGGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.526830.0stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329787720.0
Expression AtlasQ7XT42-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g46580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g46580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687490.0AK068749.1 Oryza sativa Japonica Group cDNA clone:J013158C23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635344.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ7XT420.0SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0E0PCD80.0A0A0E0PCD8_ORYRU; Uncharacterized protein
STRINGLOC_Os04g46580.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-35squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]