PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g46350.1
Common NameHOX17, LOC4336580, Os04g0548700, OSJNBa0065H10.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 248aa    MW: 27291.1 Da    PI: 8.9349
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g46350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1981135256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  LOC_Os04g46350.1  81 RKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTK 135
                       788899***********************************************98 PP

2HD-ZIP_I/II1292e-4181170191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  LOC_Os04g46350.1  81 RKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 170
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-1966131IPR009057Homeodomain-like
SuperFamilySSF466897.94E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007117.34677137IPR001356Homeobox domain
SMARTSM003898.3E-1879141IPR001356Homeobox domain
PfamPF000468.8E-1781135IPR001356Homeobox domain
CDDcd000864.35E-1681138No hitNo description
PRINTSPR000314.9E-6108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000314.9E-6117133IPR000047Helix-turn-helix motif
SMARTSM003402.7E-24137181IPR003106Leucine zipper, homeobox-associated
PfamPF021832.3E-11137171IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MMERAEDLRL SLSLSSPLIA PRTHHVAMLF HAPPEKRFLE MPLLPAAKRS EVVAAEEERA  60
GLRGGGGSDE EDGGCGIDGS RKKLRLSKDQ SAVLEDSFRE HPTLNPRQKA TLAQQLGLRP  120
RQVEVWFQNR RARTKLKQTE VDCEFLKRCC ETLTEENRRL QKEVQELRAL KLVSPHLYMN  180
MSPPTTLTMC PSCERVSNTN NNSSAAAAAD RRGIRTTTAA GGGSVVDTAA DGGILCHRPI  240
AVRPQQS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17985SRKKLRL
2129137RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.238610.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379916290.0
Expression AtlasQ0JB92-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g46350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g46350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1220060.0AK122006.1 Oryza sativa Japonica Group cDNA clone:J033110O17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634538.10.0PREDICTED: homeobox-leucine zipper protein HOX17
SwissprotQ0JB920.0HOX17_ORYSJ; Homeobox-leucine zipper protein HOX17
TrEMBLA0A0E0PCB70.0A0A0E0PCB7_ORYRU; Uncharacterized protein
STRINGLOC_Os04g46350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-64homeobox protein 2
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]