PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g46060.1
Common NameLOC4336561, Os04g0545000, OSNPB_040545000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 251aa    MW: 27197.8 Da    PI: 7.8086
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g46060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.5e-32169227159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  LOC_Os04g46060.1 169 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHT 227
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-33154227IPR003657WRKY domain
SuperFamilySSF1182902.75E-28161227IPR003657WRKY domain
PROSITE profilePS5081128.897164226IPR003657WRKY domain
SMARTSM007741.3E-37169228IPR003657WRKY domain
PfamPF031065.3E-25170226IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MYACMEGSQL ETACLPAALY APLCPYTPPS PPSFLAPLPS LQHKLPQLPQ LVHDHAAATG  60
TNHGVMFSSD HGCLYPLLPG IPFCLDSGCG AAACDDDKPA GFAHLGSAEA DTSAAAARVD  120
SEIAAAATAT TCHGPNSWWK GTEKGKMKVR RKMREPRFCF QTRSDVDVLD DGYKWRKYGQ  180
KVVKNSLHPR SYYRCTHNNC RVKKRVERLS EDCRMVITTY EGRHTHTPCS DDATTGAAGD  240
HTASCAFTSF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-24160226874Probable WRKY transcription factor 4
1wj2_A2e-24160226874Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.536410.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329837180.0
Expression AtlasQ0JBA9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g46060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g46060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736950.0AK073695.1 Oryza sativa Japonica Group cDNA clone:J033063J05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635033.10.0PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY41e-62WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLQ0JBA90.0Q0JBA9_ORYSJ; Os04g0545000 protein
STRINGLOC_Os04g46060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-59WRKY family protein