PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g45940.1
Common NameLOC4336551, Os04g0543500, OSJNBb0038F03.2, OSJNBb0103I08.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 206aa    MW: 22366.5 Da    PI: 10.7441
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g45940.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.51.9e-092081165
          trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkik 65
                      +Wt +e+laL +a++ +  +++r+ l  ++W++v+++      ++++ qC++k e+l++r +  +
  LOC_Os04g45940.1 20 CWTPDETLALARAYTARRLAVGRAHLTSADWAAVADAATP---TKTARQCRHKVEKLRRRLRSKR 81
                      8**********************************98766...57889***********998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138379.7E-81982No hitNo description
Gene3DG3DSA:1.10.10.606.9E-42177IPR009057Homeodomain-like
PROSITE profilePS500906.2492174IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MASSSPTNAA AAARRVPPPC WTPDETLALA RAYTARRLAV GRAHLTSADW AAVADAATPT  60
KTARQCRHKV EKLRRRLRSK RRRPCPLLDA IDLLDGPSPS ASPSQSPSPP PPASPPPLPP  120
APSSPPPKKR RLPDGDADAD AEDDGESDVV KALRAIGEGF LRAEQRRMEA ARKTQQMRME  180
MALRHLDSQR RLMEALVDRI IDSLE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17177KLRRRLR
27278LRRRLRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.48650.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976031100.0
Expression AtlasQ7X731-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g45940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g45940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6067280.0AL606728.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0038F03, complete sequence.
GenBankAL6066950.0AL606695.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0103I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637007.11e-141PREDICTED: leiomodin-2
TrEMBLQ7X7311e-141Q7X731_ORYSJ;
STRINGLOC_Os04g45940.11e-140(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1317245
MonocotsOGMP139112024