PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g45750.2
Common NameOs04g0541100, OSNPB_040541100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 529aa    MW: 57456.9 Da    PI: 5.8914
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g45750.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix108.54.5e-34280364186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k ev+aLi++r e++ r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+
  LOC_Os04g45750.2 280 RWPKTEVQALIQLRMELDMRYQETGPKGPLWEEISSGMRRLGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLD 364
                       8*********************************************************************8.99**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.805273337IPR017877Myb-like domain
SMARTSM007178.3E-6277339IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-4279336IPR009057Homeodomain-like
PfamPF138374.1E-23279365No hitNo description
CDDcd122038.51E-30280344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MHAFAPPVPA PPPMSAMPPP PGPIQPAPIS SAAPAVPLEL PPQPPINLQG LSFSSMSGSE  60
SDDESEDDEM TAETGGSQDR LGKRKRGAGG KRLATFFEGL IKQVVDRQEE MQRRFLETME  120
KREAERTARE EAWRRQEVAR LNREQEQLAQ ERAAAASRDA AIISFLQRIG GQSVQVPPAA  180
TVIQMPTPVQ LQTPPPVKQP ARQHQPQPTP PPPQAAPIPA APLQQQPPQP QHKETIHHEA  240
VTPRRAPPTS GSSLELVPAA EQHVESGLGG GEGGSASSSR WPKTEVQALI QLRMELDMRY  300
QETGPKGPLW EEISSGMRRL GYNRSSKRCK EKWENINKYF KKVKESNKKR PEDSKTCPYF  360
HQLDVIYRRK HLTGGGGGGA SAANVAATAI EHQNPNRHEI EGKNINDNDK RKNGGGGGAQ  420
VPTSNGDTAP TTATFDVDSG MKKPEDIVRE LSEQPPREFT TDETDSDDMG DDYTDDGEEG  480
EDDGKMQYRI QFQRPNPGGA NTAPPPATTP ASAVPTSTPT STFLAMVQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.823130.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329923480.0
Expression AtlasQ0JBC9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g45750.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g45750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071390.0AK107139.1 Oryza sativa Japonica Group cDNA clone:002-124-D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637050.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
TrEMBLQ0JBC90.0Q0JBC9_ORYSJ; Os04g0541100 protein (Fragment)
STRINGLOC_Os04g45750.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-49Trihelix family protein