PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g45690.1
Common NameLOC4336535, Os04g0540200, OsJ_15624, OSJNBa0011L07.9, OSNPB_040540200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 251aa    MW: 26733.8 Da    PI: 4.8996
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g45690.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.71.8e-06443538
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                       C+ +  + ++ fC  ++  lC+ C    H+       H+
  LOC_Os04g45690.1  4 QCDVCAAEAASVFCCADEAALCDACDRRVHSAnklagkHR 43
                      7**************************9996566777776 PP

2zf-B_box26.71.2e-085992235
          zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                      +++ C+ ++ek+  lfC++++  lC++C ++ H 
  LOC_Os04g45690.1 59 KPPLCDICQEKRGFLFCKEDRAILCRECDVTVHT 92
                      6899***************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.0E-11147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000212.49E-7347No hitNo description
PfamPF006432.0E-5444IPR000315B-box-type zinc finger
SMARTSM003364.8E-1358105IPR000315B-box-type zinc finger
PROSITE profilePS5011910.0458105IPR000315B-box-type zinc finger
PfamPF006433.9E-75992IPR000315B-box-type zinc finger
CDDcd000211.60E-861105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0009641Biological Processshade avoidance
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHSANKLAG KHRRFSLLQP LASSSSAQKP  60
PLCDICQEKR GFLFCKEDRA ILCRECDVTV HTTSELTRRH GRFLLTGVRL SSAPMDSPAP  120
SEEEEEEAGE DYSCSPSSVA GTAAGSASDG SSISEYLTKT LPGWHVEDFL VDEATAASSS  180
SDGLFQGGLL AQIGGVPDGY AAWAGREQLH SGVAVAADER ASRERWVPQM NAEWGAGSKR  240
PRASPPCLYW *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.58900.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166408040.0
Expression AtlasQ7XR92-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g45690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g45690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8301690.0CT830169.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102E21, full insert sequence.
GenBankAK0613330.0AK061333.1 Oryza sativa Japonica Group cDNA clone:006-303-A11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634023.10.0PREDICTED: B-box zinc finger protein 20 isoform X2
SwissprotQ9LQZ78e-56BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA2XVZ80.0A2XVZ8_ORYSI; Putative uncharacterized protein
TrEMBLQ7XR920.0Q7XR92_ORYSJ; AP2-EREBP transcription factor
STRINGLOC_Os04g45690.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA016847-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29841130
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.14e-29salt tolerance homolog2