PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g45650.2
Common NameOs04g0539500, OSNPB_040539500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 377aa    MW: 40004 Da    PI: 7.9602
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g45650.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.32.4e-19291325135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  LOC_Os04g45650.2 291 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 325
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-18285339IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.018285321IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.0E-14288348No hitNo description
Gene3DG3DSA:3.30.50.101.7E-15289323IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.91E-15290347No hitNo description
PROSITE patternPS003440291316IPR000679Zinc finger, GATA-type
PfamPF003202.5E-17291325IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDALKSSCRS EEAADEGAAA APSAWGMVER DGFSVEDLLD LEEFCEAEKD AAEENEQALA  60
LVAAPEEEKS KDDSQPSSVV TYELVAPPPP PPEIVDLPAH DVEELEWVSR IMDDSLSELP  120
PPPQPPASVV ASLAARPPQP RQLQRRPQDG AYRALPPASY PVRTPTICAL STEALVPVKA  180
KRSKRSRATA WSLSGAPPFS DSTSSSSTTT TSSCSSSASF SSFSPLLKFE WHPLGGTSDL  240
PDDHLLPPGK KSKHGKNGKN KPKKRGRKPK QLPPHPSGAA ASAPAPGDRR CSHCGVQKTP  300
QWRAGPEGAK TLCNACGVRY KSGRLLPEYR PACSPTFVSA IHSNSHRKVL EMRRKKEVGS  360
GLLTAAAAAA PAVASF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.184490.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379892340.0
Expression AtlasA0A0P0WDC5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g45650.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g45650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0991440.0AK099144.1 Oryza sativa Japonica Group cDNA clone:J023055K24, full insert sequence.
GenBankAK0605740.0AK060574.1 Oryza sativa Japonica Group cDNA clone:001-023-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636682.10.0PREDICTED: GATA transcription factor 6
TrEMBLA0A0P0WDC50.0A0A0P0WDC5_ORYSJ; Os04g0539500 protein
TrEMBLQ01IQ10.0Q01IQ1_ORYSA; H0115B09.1 protein
TrEMBLA0A0E0H3N80.0A0A0E0H3N8_ORYNI; Uncharacterized protein
STRINGBGIOSGA016846-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-40GATA transcription factor 5