PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g45060.1
Common NameLOC107276813, OSJNBb0039L24.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 299aa    MW: 31799.5 Da    PI: 6.3629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g45060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed+llvd+v+  G+g+W++ ++  g++R++k+c++rw +yl
  LOC_Os04g45060.1 14 KGPWTPDEDKLLVDYVQANGSGNWRLLPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding52.31.3e-1667110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T+eE++ ++++++  G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os04g45060.1  67 RGPFTPEEHKSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNT 110
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.985961IPR017930Myb domain
SMARTSM007173.9E-141363IPR001005SANT/Myb domain
SuperFamilySSF466892.27E-3113108IPR009057Homeodomain-like
PfamPF002494.5E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-241568IPR009057Homeodomain-like
CDDcd001678.84E-111661No hitNo description
PROSITE profilePS5129425.33562116IPR017930Myb domain
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1467110IPR001005SANT/Myb domain
CDDcd001678.15E-1169112No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRTPCCDSK VLKKGPWTPD EDKLLVDYVQ ANGSGNWRLL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEHKSILQ LHAIVGNKWS MIAAQLPGRT DNEIKNYWNT NVKKQLRQGQ  120
AAAVGEQAAL ASLGGGAASC PAARHMAQWE TARLEAEARL SLLSGTTSVA TASVAASSSS  180
SSTAAAGGAE APPDIYLRLW NSEVGDSFRK SARSAAREDQ EPANASDEAA PVSATFARPG  240
DDSSAASNVT AAAAADEYQV FLDLAAEDFE LFHGRHGGFP LFPAVDMLGE TSLYTAFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XMK6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g45060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g45060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6630060.0AL663006.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0039L24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636233.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLQ7XMK60.0Q7XMK6_ORYSJ;
TrEMBLI1PNC10.0I1PNC1_ORYGL; Uncharacterized protein
STRINGLOC_Os04g45060.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0169000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-66myb domain protein 17