PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g43680.1
Common NameLOC4336407, LTR1, MYB4, Os04g0517100, OSJNBa0073E02.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 258aa    MW: 27914.4 Da    PI: 7.0559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g43680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
  LOC_Os04g43680.1 14 KGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding51.32.6e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  LOC_Os04g43680.1  67 RGNFSKEEEDTIIHLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129416.37961IPR017930Myb domain
SuperFamilySSF466893.23E-3110108IPR009057Homeodomain-like
SMARTSM007172.3E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
CDDcd001675.34E-111661No hitNo description
PROSITE profilePS5129425.29162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.0E-1567112IPR001005SANT/Myb domain
CDDcd001675.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKVLVAHIQ RHGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SKEEEDTIIH LHELLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLDAPA  120
QGGHVAASGG KKHKKPKSAK KPAAAAAAPP ASPERSASSS VTESSMASSV AEEHGNAGIS  180
SASASVCAKE ESSFTSASEE FQIDDSFWSE TLSMPLDGYD VSMEPGDAFV APPSADDMDY  240
WLGVFMESGE AQDLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121185110B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XBH4
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor which is may be involved in cold stress response. {ECO:0000269|PubMed:14675437}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g43680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|Ref.1}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g43680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY114140.0Y11414.1 O.sativa mRNA for myb factor, 1202 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633465.10.0PREDICTED: myb-related protein Myb4
SwissprotQ7XBH40.0MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ01J530.0Q01J53_ORYSA;
TrEMBLQ0JBQ50.0Q0JBQ5_ORYSJ; Os04g0517100 protein
STRINGLOC_Os04g43680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-76myb domain protein 15
Publications ? help Back to Top
  1. Vannini C, et al.
    Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.
    Plant J., 2004. 37(1): p. 115-27
    [PMID:14675437]