PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g43560.1
Common NameLOC4336400, Os04g0515900, OSJNBb0070J16.15, OSJNBb0072M01.11, OSNPB_040515900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 279aa    MW: 30802.3 Da    PI: 6.4017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g43560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15.1e-51101371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF P+deelv++yL kkv++++ +   ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev 
  LOC_Os04g43560.1  10 LPPGFRFYPSDEELVCHYLYKKVSNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVR 101
                       79*************************888.88***************77777889************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s  ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  LOC_Os04g43560.1 102 SPaTRAVVGMRKTLVFYQGRAPNGVKSGWVMHEFRL 137
                       *977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-608156IPR003441NAC domain
PROSITE profilePS5100558.73810156IPR003441NAC domain
PfamPF023654.3E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVSNERASQG TLVEVDLHAR EPWELPDVAK  60
LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPATRAVVG MRKTLVFYQG  120
RAPNGVKSGW VMHEFRLDSP HSPPKEDWVL CRVFQKSKGD GEQDNPTSAA SPAATFAGSS  180
QAAVPGQAAY SSDDHTGSSM GFAPRQNEIL DSSSHQLLNL AMLQCNSVLD HFPQEVNSSP  240
MMGLAGSIGI GDEYGFFYDT GFEETASLGG MRFPQGWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5011564165NAC domain-containing protein 19
4dul_A2e-5011564165NAC domain-containing protein 19
1ut7_B2e-5011564165NO APICAL MERISTEM PROTEIN
1ut7_A2e-5011564165NO APICAL MERISTEM PROTEIN
1ut4_B2e-5011564165NO APICAL MERISTEM PROTEIN
1ut4_A2e-5011564165NO APICAL MERISTEM PROTEIN
3swp_D2e-5011567168NAC domain-containing protein 19
3swp_C2e-5011567168NAC domain-containing protein 19
3swp_B2e-5011567168NAC domain-containing protein 19
3swp_A2e-5011567168NAC domain-containing protein 19
3swm_D2e-5011567168NAC domain-containing protein 19
3swm_C2e-5011567168NAC domain-containing protein 19
3swm_B2e-5011567168NAC domain-containing protein 19
3swm_A2e-5011567168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.366510.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7X7J4
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g43560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g43560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0629550.0AK062955.1 Oryza sativa Japonica Group cDNA clone:001-109-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634235.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FRV45e-64NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA2XVI60.0A2XVI6_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0GXN10.0A0A0E0GXN1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PBK50.0A0A0E0PBK5_ORYRU; Uncharacterized protein
TrEMBLA0A0D9ZN590.0A0A0D9ZN59_9ORYZ; Uncharacterized protein
TrEMBLQ7X7J40.0Q7X7J4_ORYSJ;
STRINGLOC_Os04g43560.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA016756-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-82NAC domain containing protein 74