PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g42950.1
Common NameLOC4336355, Os04g0508500, OSNPB_040508500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 282aa    MW: 30659.2 Da    PI: 7.572
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g42950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-182572148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT +Ed llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
  LOC_Os04g42950.1 25 KGPWTSQEDALLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 72
                      79********************************************97 PP

2Myb_DNA-binding54.23.3e-1778122147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  LOC_Os04g42950.1  78 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 122
                       8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6542072IPR017930Myb domain
SuperFamilySSF466891.39E-2923119IPR009057Homeodomain-like
SMARTSM007171.5E-152474IPR001005SANT/Myb domain
PfamPF002499.9E-172572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-232679IPR009057Homeodomain-like
CDDcd001679.67E-122772No hitNo description
PROSITE profilePS5129425.39673127IPR017930Myb domain
SMARTSM007176.6E-1677125IPR001005SANT/Myb domain
PfamPF002491.0E-1478122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2480125IPR009057Homeodomain-like
CDDcd001675.10E-1182123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAAAEVQSAA GWGRQLQQDG GGWRKGPWTS QEDALLVEHV RQHGEGRWNS VSKLTGLKRS  60
GKSCRLRWVN YLRPDLKRGK ITPQEESIIV QLHALWGNRW STIARSLPGR TDNEIKNYWR  120
THFKKGKPSK NIERARARFL KQRREMQQSQ QLQQPTLMPT PTPQSKDIIV AETGDARTDD  180
DAGGAAAAVA PSSSSSSLSM GGGEAEDLIM HQDAMDDLMM CPAMSYHLIL HGAAVAGHQL  240
SDGGGSCCAS TSEDYGSSED DGATWGSLWN LDGAAGACTL W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-2741259126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329948290.0
Expression AtlasA0A0P0WCH5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g42950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g42950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096200.0AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634463.10.0PREDICTED: transcription factor WER
TrEMBLA0A0P0WCH50.0A0A0P0WCH5_ORYSJ; Os04g0508500 protein
STRINGBGIOSGA014750-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-66myb domain protein 79