PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g42020.1
Common NameLOC4336288, Os04g0497700, OSJNBa0067K08.19, OSNPB_040497700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 334aa    MW: 34604.2 Da    PI: 4.8578
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g42020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box248.2e-082056437
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....H 37
                      r C+ ++ + ++lfC+ +  +lC+ C    H g    H
  LOC_Os04g42020.1 20 RACDACGGEAARLFCRADAAFLCAGCDARAH-GpgsrH 56
                      68*************************9999.545556 PP

2zf-B_box22.91.8e-0759103341
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                        + C+ +e+ ++   C+ +   lC+ C   +H+       H++ p
  LOC_Os04g42020.1  59 VWLCEVCEHAPAAVTCRADAAALCAACDADIHSAnplarrHERLP 103
                       679*****************************6688888898877 PP

3CCT67.73.2e-23239282144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  LOC_Os04g42020.1 239 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRT 282
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-91761IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4241761IPR000315B-box-type zinc finger
CDDcd000212.52E-92061No hitNo description
PfamPF006434.7E-62057IPR000315B-box-type zinc finger
PROSITE profilePS5011910.42457104IPR000315B-box-type zinc finger
PfamPF006438.0E-659104IPR000315B-box-type zinc finger
SMARTSM003364.6E-962104IPR000315B-box-type zinc finger
PfamPF062039.4E-18239281IPR010402CCT domain
PROSITE profilePS5101716.876239281IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEGDDKSAVV GGAYWGLAAR ACDACGGEAA RLFCRADAAF LCAGCDARAH GPGSRHARVW  60
LCEVCEHAPA AVTCRADAAA LCAACDADIH SANPLARRHE RLPVAPFFGA LADAPKPGSG  120
AHGGDAAAAD DDGSNDAEAA SWLLPEPDHG QKDGAVGATD ELYADSDPYL DLDFARSMDD  180
IKAIGVQNGP PELDITGGKL FYSDHSMNHS VSSSEAAVVP DAAAGGGAPM PVVSRGRERE  240
ARLMRYREKR KSRRFEKTIR YASRKAYAET RPRIKGRFAK RTKGGAGADA DADADADGED  300
EEMYSSAAAA VAALMAPGGS DADYGVDGVV PTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.465980.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906470.0
Expression AtlasQ7XQH7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g42020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g42020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1210240.0AK121024.1 Oryza sativa Japonica Group cDNA clone:J023049O11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633841.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0PB250.0A0A0E0PB25_ORYRU; Uncharacterized protein
TrEMBLI1PMN90.0I1PMN9_ORYGL; Uncharacterized protein
TrEMBLQ7XQH70.0Q7XQH7_ORYSJ;
STRINGLOC_Os04g42020.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0145800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.14e-48CONSTANS-like 3