PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g41850.1
Common NameJ033120P08, LOC4336275, NLP2, Os04g0495800, OsJ_15319, OSJNBa0067K08.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 937aa    MW: 101603 Da    PI: 6.0227
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g41850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.5e-29564615152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isl++l+kyFs+++kdAAk+Lgvc+T+LKriCR++GI+RWP+Rki+++
  LOC_Os04g41850.1 564 AEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKINKV 615
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995550635IPR003035RWP-RK domain
PfamPF020426.8E-26567615IPR003035RWP-RK domain
SuperFamilySSF542772.68E-24825917No hitNo description
Gene3DG3DSA:3.10.20.2405.2E-22831913No hitNo description
SMARTSM006662.7E-21834916IPR000270PB1 domain
PROSITE profilePS5174526.556834916IPR000270PB1 domain
PfamPF005641.2E-16835915IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MDMPTPSNRA GCNGNTGGTM GPSDDPYGAA AMNLDCYSEI YSPSVADQLF SLLNDPAAHR  60
MFAMWPSMGS SPCAAGTSED MPLDAYSGLG EAVEEPSQIM SVNPTEAEKT GKSSGELGSD  120
DGAHQGSSMV PRSVVGSSLA DRMLMALSLF RESLGSGALA QVWMPVEQEG HVVLSTCEQP  180
FLLDQVLAGY REVSRHFVFS AKEEPGLQPG LPGRVFISGV PEWTSSVLYY NRPEYLRMEH  240
ALHHEIRGSL AMPIYDPSKD SCCAVFELVT RKEKPDFSAE MDNVCNALQA VNLKATKGSS  300
NQKFYTENQK FAFTEILDVL RAICHAHMLP LALTWVPTSN GIDGGYVVGK DGASFSQSGK  360
TIIRIHESAC YVNDGKMQGF LQACARRHLE KGQGIAGRAL KSNLPFFSPD IREYSIEDYP  420
LAHHARKFSL HAAVAIRLRS TYTGNDDYIL EFFLPVSCKG SGEQQMLLNN LSSTMQRICK  480
SLRTVYEAEV DNVNAGTAAV FRKNNESCLP TGHTESSSHG DQSITGASFE DTSLANKPGV  540
MEPELAEQVQ PSSIGHAEKK RSTAEKNISL DVLRKYFSGS LKDAAKSLGV CPTTLKRICR  600
HHGISRWPSR KINKVNRSLK KIQTVINSVH GVDRSLQYDP ATGSLVPVVS LPEKLTFPSC  660
DGLPTPSVGK TVEENSDLKS EEGCSLPDGS QRQSCQLQIS DVKKSNEDEF HIGSGNSDFY  720
GANATAKSNS EVTQGPLCPT GAFSALHLKG TDCTNPSSSL RPSSESTRNQ IVGRNSPSIQ  780
QEDLDMLDNH EAEDKDHMHP STSGMTDSSS GSASSHPTFK QNTRSALKDA ASPALTVKAT  840
YNGDTVRFKF LPSMGWYHLL EEIAKRFKLP TGAYQLKYKD DEDEWVILAN DSDLQECVDV  900
LDSIGSRIVK LQVRDLPCIV SSSGSSTCLQ LAAHSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.173770.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329883630.0
Expression AtlasQ0JC27-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g41850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g41850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1031540.0AK103154.1 Oryza sativa Japonica Group cDNA clone:J033120P08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636521.10.0PREDICTED: protein NLP2
RefseqXP_015636522.10.0PREDICTED: protein NLP2
RefseqXP_015636523.10.0PREDICTED: protein NLP2
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLI1PMM50.0I1PMM5_ORYGL; Uncharacterized protein
STRINGLOC_Os04g41850.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]