PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g41820.1
Common NameLOC4336273, OsJ_15316, OSJNBa0067K08.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 470aa    MW: 50079.3 Da    PI: 8.1567
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g41820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.15.8e-11270328563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l+     l+se+
  LOC_Os04g41820.1 270 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTSEN 328
                       9***********************************************99999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-18266330IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139268331IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-11270325No hitNo description
PfamPF001702.2E-9270328IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.01E-11270325No hitNo description
CDDcd147031.13E-23271320No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MAESRIFGGL KPTKSRLLGP TIRGPPPNGA ATHAPRRILF SFSPESQWLG QSSTRACLPP  60
LRSPCLPAPS AASPAYPRLA SSAASASAPA RLRSRITLPG GRSPVPPMDP AASAAESSSL  120
SSRDVAAMPD SPPRRAARHR RAQSEILLGA ALPDDIAFDA DLGVVGEVGG GGGDDYEEEE  180
EDDEEEEMEG AGGSRMFEMF LEAGGKLETP EPAAPLPPPP ARPRHQHSMS MDGSTSLASS  240
AAGVAGRMGA DAKKAISDAK LAELALVDPK RAKRILANRQ SAARSKERKM RYIAELERKV  300
QTLQTEATTL SAQLSMLQRD TTGLTSENSD LKIRVQTMEQ QVRLQDALND RLRDEIQQLK  360
VATGQVNANC GKVGNFGLSS FGGANPQGYQ RSHIQSLLAA QQLQQLQIHS QHQQQQMHLQ  420
QHHHLSTVQQ QLLQEGLPLP GDLKMKGIVA ASHAQNAGAS ESHALRSEP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.519670.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329744470.0
Expression AtlasQ7XUJ7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g41820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g41820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066270.0AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633411.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-84POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0E0PB010.0A0A0E0PB01_ORYRU; Uncharacterized protein
TrEMBLQ7XUJ70.0Q7XUJ7_ORYSJ;
STRINGLOC_Os04g41820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-65bZIP family protein