PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g41560.4
Common NameLOC4336260, OJ990528_30.8, Os04g0493000, OSJNBb0091E11.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 182aa    MW: 18937.5 Da    PI: 5.5767
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g41560.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.51.1e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  LOC_Os04g41560.4  4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                      6******99*********************6678888898877 PP

2zf-B_box27.56.6e-095586334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  LOC_Os04g41560.4 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86
                      589**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.096147IPR000315B-box-type zinc finger
SMARTSM003364.6E-9447IPR000315B-box-type zinc finger
PfamPF006431.7E-5447IPR000315B-box-type zinc finger
SMARTSM003365.0E-1453100IPR000315B-box-type zinc finger
PROSITE profilePS501198.53253100IPR000315B-box-type zinc finger
PfamPF006431.5E-65696IPR000315B-box-type zinc finger
CDDcd000217.75E-75686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LPAALPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLT TGIRVGFSSV CSANADHLPP  120
PAPKGNSKPP ASGIAAAAAP KPAVSAAAQE VPSSPFLPPS GWAVEDLLQL SDYESSDKAR  180
T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1000630.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasO82113
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g41560.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g41560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3248050.0HQ324805.1 Oryza sativa Japonica Group clone KCB761B05 zinc finger protein mRNA, complete cds.
GenBankAB0018830.0AB001883.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:E10707.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636444.11e-125PREDICTED: B-box zinc finger protein 24
SwissprotQ962881e-59BBX24_ARATH; B-box zinc finger protein 24
TrEMBLO821131e-125O82113_ORYSJ; OJ990528_30.8 protein
STRINGLOC_Os04g41560.21e-125(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.22e-37DBB family protein
Publications ? help Back to Top
  1. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]