PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g41560.2
Common NameLOC4336260, OJ990528_30.8, Os04g0493000, OSJNBb0091E11.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 258aa    MW: 27136.7 Da    PI: 4.6705
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g41560.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.72e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  LOC_Os04g41560.2  4 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                      6******99*********************6678888898877 PP

2zf-B_box26.71.2e-085586334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  LOC_Os04g41560.2 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86
                      589**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.096147IPR000315B-box-type zinc finger
SMARTSM003364.6E-9447IPR000315B-box-type zinc finger
PfamPF006433.0E-5447IPR000315B-box-type zinc finger
SMARTSM003365.0E-1453100IPR000315B-box-type zinc finger
PROSITE profilePS501198.53253100IPR000315B-box-type zinc finger
PfamPF006432.6E-65696IPR000315B-box-type zinc finger
CDDcd000211.16E-75686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MRIQCDACEA AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDAA LPAALPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLT TGIRVGFSSV CSANADHLPP  120
PAPKGNSKPP ASGIAAAAAP KPAVSAAAQE VPSSPFLPPS GWAVEDLLQL SDYESSDKKG  180
SPIGFKDLEW LDDIDLFHVQ SPAKGGSTAA EVPELFASPQ PASNMGLYKA SGARQSKKPR  240
VEIPDDDEDF FIVPDLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1000630.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasO82113
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g41560.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g41560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3248050.0HQ324805.1 Oryza sativa Japonica Group clone KCB761B05 zinc finger protein mRNA, complete cds.
GenBankAB0018830.0AB001883.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:E10707.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636444.10.0PREDICTED: B-box zinc finger protein 24
SwissprotQ962881e-74BBX24_ARATH; B-box zinc finger protein 24
TrEMBLO821130.0O82113_ORYSJ; OJ990528_30.8 protein
STRINGLOC_Os04g41560.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53971020
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.18e-51DBB family protein
Publications ? help Back to Top
  1. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]