PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g39570.1
Common NameLOC4336126, Os04g0471700, OSNPB_040471700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 999aa    MW: 103636 Da    PI: 5.9795
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g39570.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.51.8e-30523580260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +Dgy+WrKYGqK+vk se+prsYY+Ct+a+C vkkkvers+ +++v+ei+Y+g+Hnh+k
  LOC_Os04g39570.1 523 EDGYSWRKYGQKQVKHSEYPRSYYKCTHASCAVKKKVERSH-EGHVTEIIYKGTHNHPK 580
                       8****************************************.***************85 PP

2WRKY104.74.9e-33754812159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+++d k v++tYeg+Hnhe
  LOC_Os04g39570.1 754 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCLVRKHVERASHDLKSVITTYEGKHNHE 812
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-27511581IPR003657WRKY domain
PROSITE profilePS5081123.571517581IPR003657WRKY domain
SuperFamilySSF1182901.1E-24518581IPR003657WRKY domain
SMARTSM007746.1E-33522580IPR003657WRKY domain
PfamPF031062.5E-23523579IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-36739814IPR003657WRKY domain
SuperFamilySSF1182908.63E-29746814IPR003657WRKY domain
PROSITE profilePS5081137.7749814IPR003657WRKY domain
SMARTSM007749.2E-39754813IPR003657WRKY domain
PfamPF031066.4E-25755812IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MTMTTATLDP PPPPLLIAGS LLDDDRDAGS AASSSPRWLP RARGSTVGSP PRRGGEERGG  60
EAATRRKGNS SCPDDDDDCR NDEDDCRNDD DYRDDDVGAT TDGGGDAAAL LPMAMMTATT  120
MAPMPVEAAV DGGGELSSAG EGGQRRVNLL PTKILSAYEN HLFSQALACR EDEWIIEKLA  180
VIAARRSSFV SEESLCSVPA AALVSLAIAH LAFSPMLVYG VLDRLCSVCH LGEMEGDIAM  240
EEWKDSNHRG ADYLMTMPMQ NFLADAFPPP ELLEGEGGFE KHGLSVAVGS PPPTPPPPED  300
GCSPLPLTPQ FGQKFGSGGG GGGSLADRRA RGGFSNVARI SVPYNQPAAD VSSAGAPSPY  360
VTIPPGLSPT TLLESPVFSN AMGQASPTTG KLHMLGGAND SNPIRFESPR IEEGSGAFSF  420
KPLNLASSHY AAEEKTKSLP NNQHQSLPIS VKTEATSIQT AQDEAAANQL MQPQFNGGKR  480
SRAAPDNGGD GEGQPAEGDA KADSSSGAAA VAVVAAAAAA VAEDGYSWRK YGQKQVKHSE  540
YPRSYYKCTH ASCAVKKKVE RSHEGHVTEI IYKGTHNHPK PAASRRPPVH PPPPSPATTT  600
TTPLPPGDAQ ADHAPDGGGG STPVGAGQAG AEWHNGGVVG GEGLVDATSS PSVPGELCES  660
TASMQVHEGA AAAQLGESPE GVDVTSAVSD EVDRDDKATH VLPLAAAAAD GESDELERKR  720
RKLDSCATMD MSTASRAVRE PRVVIQTTSE VDILDDGYRW RKYGQKVVKG NPNPRSYYKC  780
THPGCLVRKH VERASHDLKS VITTYEGKHN HEVPAARNSG HPAGSASPGG GAGSSSQPHG  840
VGVGGRRPEV PSVQESLMRL GGGCGAAPFP PHFGLHLPPP PPRDPLAPMS NFPYSLGHAP  900
SPALRGLPPP PPPPPSASAL AVAGLGGVVE GLKYPMLAPP SVHSLLRHRQ GGGMEAVVVP  960
KAEVKQEAMR PAAAVAGAGR GAAVYQQAMS RVSLGNQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-36505815278Probable WRKY transcription factor 4
2lex_A6e-36505815278Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191730.0
Expression AtlasQ7XAA9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g39570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g39570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418430.0AY341843.1 Oryza sativa (japonica cultivar-group) WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634497.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
TrEMBLQ7XAA90.0Q7XAA9_ORYSJ; Os04g0471700 protein
STRINGLOC_Os04g39570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.13e-93WRKY DNA-binding protein 2