PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g39470.1
Common NameLOC9272494, MYB80, Os04g0470600, OSJNBa0089K21.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 373aa    MW: 39699.2 Da    PI: 6.1455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g39470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  LOC_Os04g39470.1 14 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                      89********************************************97 PP

2Myb_DNA-binding45.12.3e-1468110246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os04g39470.1  68 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.857965IPR017930Myb domain
SuperFamilySSF466899.94E-3011108IPR009057Homeodomain-like
SMARTSM007173.8E-141363IPR001005SANT/Myb domain
PfamPF002496.4E-171461IPR001005SANT/Myb domain
CDDcd001671.56E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.19766116IPR017930Myb domain
PfamPF002496.8E-1368110IPR001005SANT/Myb domain
CDDcd001672.70E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRVPCCEKD NVKRGQWTPE EDNKLLSYIT QYGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF TDAEEQTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKSFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRPS DFPSPAVHDG  180
AGAGASASAL AAPCFPAAPP HHPQADDTIE RIKLGLSRAI MSDPSTASAA AAAAAPSAPA  240
EDKPWPPGDM SEGLAGMYAT YNPAAHAHAQ AQAEFRYDGA SAAQGYVLGG DGDQGTSMWS  300
HQSLYSGSSG TEEARRELPE KGNDSVGSSG GDDDAADDGK DSGKGAASDM SGLFASDCVL  360
WDLPDELTNH MV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.581660.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977232240.0
Expression AtlasQ7XQN1-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in developing anthers during meiosis and young microspore stages. {ECO:0000269|PubMed:16141453}.
Functional Description ? help Back to Top
Source Description
UniProtEssential for tapetum development in anthers and microsporogenesis. May regulate the timing of tapetal programmed cell death (PCD) which is critical for pollen development. {ECO:0000269|PubMed:22086333}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g39470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g39470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6064410.0AL606441.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0089K21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635420.10.0PREDICTED: transcription factor MYB30
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLQ01J670.0Q01J67_ORYSA; H0418A01.1 protein
STRINGLOC_Os04g39470.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-112myb domain protein 103
Publications ? help Back to Top
  1. Jung KH, et al.
    Rice Undeveloped Tapetum1 is a major regulator of early tapetum development.
    Plant Cell, 2005. 17(10): p. 2705-22
    [PMID:16141453]
  2. Phan HA,Li SF,Parish RW
    MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops.
    Plant Mol. Biol., 2012. 78(1-2): p. 171-83
    [PMID:22086333]