PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g38740.1
Common NameLOC4336055, Os04g0461000, OSJNBa0072F16.11, OSNPB_040461000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 346aa    MW: 36392.8 Da    PI: 7.6649
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g38740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  LOC_Os04g38740.1 14 KGPWTPEEDQKLLAYIEQHGHGCWRSLPSKAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding53.17.4e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  LOC_Os04g38740.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.859961IPR017930Myb domain
SuperFamilySSF466895.14E-3011108IPR009057Homeodomain-like
SMARTSM007177.9E-151363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001673.76E-121661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.9E-1667112IPR001005SANT/Myb domain
CDDcd001671.12E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLAYIE QHGHGCWRSL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DVAGAGGGGG GAAGGAAGAQ HAKAAAHLSH TAQWESARLE AEARLAREAK  180
LRALAASATP GAPHLPAPPA SAAAAAAAHG LDSPTSTLSF SESAVLATVL EAHGAAAAAA  240
ARAAMQPMQA YDEACKDQHW GDVDAADVGF PGAGAGFTGL LLEGSLNQIP RPAGRDAEAD  300
GEFQETEEEK NYWNSILNLV NSSSAPMSTA VVVPASHAYS PAPDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.808470.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567650300.0
Expression AtlasQ7XUV5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g38740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g38740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2884150.0AK288415.1 Oryza sativa Japonica Group cDNA, clone: J090031E07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635111.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA2XU960.0A2XU96_ORYSI; Putative uncharacterized protein
TrEMBLQ7XUV50.0Q7XUV5_ORYSJ;
STRINGLOC_Os04g38740.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA016547-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.15e-93myb domain protein 106