PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g38720.1
Common NameLOC4336052, Os04g0460600, OsJ_15058, OSJNBa0072F16.10, OSNPB_040460600, TIL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 344aa    MW: 36838.7 Da    PI: 7.6435
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g38720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-55121371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL+kkv++ ++ +  +++e+d++k+ePwdLp+ +k +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdk+++
  LOC_Os04g38720.1  12 LPPGFRFHPTDEELITHYLAKKVADARFAA-LAVAEADLNKCEPWDLPSLAKMGEKEWYFFCLKDRKYPTGLRTNRATESGYWKATGKDKDIF 103
                       79*************************999.67***************8888899************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +++lvg+kktLvfy+grapkgek+ Wvmheyrl
  LOC_Os04g38720.1 104 R-RKALVGMKKTLVFYTGRAPKGEKSGWVMHEYRL 137
                       *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-647168IPR003441NAC domain
PROSITE profilePS5100558.41412168IPR003441NAC domain
PfamPF023657.1E-3013137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEQHQGQAGM DLPPGFRFHP TDEELITHYL AKKVADARFA ALAVAEADLN KCEPWDLPSL  60
AKMGEKEWYF FCLKDRKYPT GLRTNRATES GYWKATGKDK DIFRRKALVG MKKTLVFYTG  120
RAPKGEKSGW VMHEYRLHGK LHAAALGFLH GKPASSKNEW VLCRVFKKSL VEVGAAGGKK  180
AAVVTMEMAR GGSTSSSVAD EIAMSSVVLP PLMDMSGAGA GAVDPATTAH VTCFSNALEG  240
QFFNPTAVHG HGGGDSSPFM ASFTQYGQLH HGVSLVQLLE SCNGYGGLVD MAASGSQLQP  300
AACGGERERL SASQDTGLTS DVNPEISSSS GQKFDHEAAL WGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-5421695169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.157080.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166407430.0
Expression AtlasQ7XUV6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g38720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g38720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5206410.0DQ520641.1 Oryza sativa (japonica cultivar-group) NAC domain protein (TIL1) mRNA, complete cds.
GenBankCT8301070.0CT830107.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA218A09, full insert sequence.
GenBankAB0281810.0AB028181.1 Oryza sativa mRNA for OsNAC2 protein, complete cds.
GenBankAK1046260.0AK104626.1 Oryza sativa Japonica Group cDNA clone:006-310-B03, full insert sequence.
GenBankAK0617450.0AK061745.1 Oryza sativa Japonica Group cDNA clone:001-038-F10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633922.10.0PREDICTED: NAC domain-containing protein 92
RefseqXP_015633924.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLR34e-97NAC79_ARATH; NAC domain-containing protein 79
TrEMBLB8AUR10.0B8AUR1_ORYSI; Putative uncharacterized protein
TrEMBLQ01II70.0Q01II7_ORYSA; H0219H12.10 protein
TrEMBLQ7XUV60.0Q7XUV6_ORYSJ; NAC domain protein
TrEMBLA0A0E0PA440.0A0A0E0PA44_ORYRU; Uncharacterized protein
STRINGBGIOSGA016546-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g38720.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.23e-83NAC domain containing protein 80