PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g35660.1
Common NameLOC4335910, Os04g0437000, OsJ_14893, OSJNBa0006B20.9, OSNPB_040437000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 201aa    MW: 22517.2 Da    PI: 5.7758
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g35660.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.34.8e-3071231128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGf+F P+deel+ ++L++k++  +++  ++++++ ++ ++Pw+L+ k+ ++ ++wyfFs++ +        +r+  +g Wk     ++v+
  LOC_Os04g35660.1   7 LPPGFHFFPSDEELIIHFLRRKASLLPCQP-DIVPTLILNLYDPWELNGKALQSGNQWYFFSHATQ--------TRTSPNGHWKPIAD-ETVI 89 
                       79*************************999.89**************976667789******9754........577889****9976.6666 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +g +vglkktL+f+ g+  ++ kt+Wvmhey+l
  LOC_Os04g35660.1  90 S-GGCNVGLKKTLIFFIGEPFEAIKTNWVMHEYHL 123
                       7.7999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-423164IPR003441NAC domain
PROSITE profilePS5100539.1317165IPR003441NAC domain
PfamPF023652.8E-208123IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAGASNLPPG FHFFPSDEEL IIHFLRRKAS LLPCQPDIVP TLILNLYDPW ELNGKALQSG  60
NQWYFFSHAT QTRTSPNGHW KPIADETVIS GGCNVGLKKT LIFFIGEPFE AIKTNWVMHE  120
YHLMDGSTNC SSSSTSSSSS KRSHKKKGHS DTESKNWVIC RVFESSYDSQ VSFHEEGTEL  180
SCLDEVFLSL DDYDEVSFAK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-31617016170NO APICAL MERISTEM PROTEIN
1ut4_B2e-31617016170NO APICAL MERISTEM PROTEIN
1ut7_A2e-31617016170NO APICAL MERISTEM PROTEIN
1ut7_B2e-31617016170NO APICAL MERISTEM PROTEIN
3swm_A2e-31617019173NAC domain-containing protein 19
3swm_B2e-31617019173NAC domain-containing protein 19
3swm_C2e-31617019173NAC domain-containing protein 19
3swm_D2e-31617019173NAC domain-containing protein 19
3swp_A2e-31617019173NAC domain-containing protein 19
3swp_B2e-31617019173NAC domain-containing protein 19
3swp_C2e-31617019173NAC domain-containing protein 19
3swp_D2e-31617019173NAC domain-containing protein 19
4dul_A2e-31617016170NAC domain-containing protein 19
4dul_B2e-31617016170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.583900.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160129500.0
Expression AtlasQ7XV60-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g35660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g35660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2435850.0AK243585.1 Oryza sativa Japonica Group cDNA, clone: J100082O14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634043.11e-149PREDICTED: NAC transcription factor 29
SwissprotQ8GWK61e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0D9ZL291e-149A0A0D9ZL29_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0P9G51e-149A0A0E0P9G5_ORYRU; Uncharacterized protein
TrEMBLQ7XV601e-149Q7XV60_ORYSJ;
STRINGLOC_Os04g35660.11e-149(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP45101024
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-57xylem NAC domain 1