PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g28130.1
Common NameOs04g0348800, OSJNBa0020I02.17, RR29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 391aa    MW: 43326.9 Da    PI: 5.7511
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g28130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.22.4e-15173222455
           G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       l Wtp L ++F++a++ L G++ A Pk+i+++m+v+ +   +++ HLQk+Rl
  LOC_Os04g28130.1 173 LMWTPHLQKKFLHALQIL-GKD-ASPKNIKKIMGVDNIDCRQIAAHLQKHRL 222
                       78****************.665.****************************8 PP

2Response_reg532e-18151232108
                       EEESSSHHHHHHHHHHHH.HTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   2 livdDeplvrellrqale.kegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       +++d+++  ++    +l+ + ++ +v++++++ +al+ l+++   +Dl+l D+ m +m+G+++lk  re ++++++i+++++ ++ ++++++k
  LOC_Os04g28130.1  15 MVIDEDKCHADSTSYMLSaELNF-SVTVFTSPIKALDFLQNHAegVDLVLADVHMEEMNGFDFLKVARELHKSIQVIMMSTETTMYTMKRCVK 106
                       899***************9999*.******************999************************************************ PP

                       TTESEEEESS--HHHHH CS
      Response_reg  92 aGakdflsKpfdpeelv 108
                       +Ga+  + Kp d   + 
  LOC_Os04g28130.1 107 LGAQFLVNKPLDAGTIK 123
                       **********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.27E-2311129IPR011006CheY-like superfamily
SMARTSM004483.2E-1112126IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.7E-2312129No hitNo description
PROSITE profilePS5011027.11813130IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.68E-1615119No hitNo description
PfamPF000729.3E-1715123IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466891.97E-12167226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-15168225IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-15173223IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAQKEGLPAG RLSAMVIDED KCHADSTSYM LSAELNFSVT VFTSPIKALD FLQNHAEGVD  60
LVLADVHMEE MNGFDFLKVA RELHKSIQVI MMSTETTMYT MKRCVKLGAQ FLVNKPLDAG  120
TIKNLWQYVD LKVLRMEKIK DLLQGIGDES TCANETNSLA ENPKNDTKKK YYLMWTPHLQ  180
KKFLHALQIL GKDASPKNIK KIMGVDNIDC RQIAAHLQKH RLRLTKDLKK ASFTTDTSKD  240
ESNSRIGPAE SHHVCRNAST LQPRSNTQPT ETTMQILSED AEYDDVYAAM RRALQYGIVF  300
DESKHSSDPS GDEDEQVVVG GDQDGCANEA NDIDSSGDHH QVAAVVTKPC NANASQEIIN  360
KMTNSDGMQA TKGSKAAVFR LVDYSESDSD *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.234830.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XS69
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g28130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, lesion mimic, low tillering and late heading phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g28130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6629630.0AL662963.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0020I02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691407.11e-178PREDICTED: two-component response regulator ORR29-like
SwissprotQ7XS690.0ORR29_ORYSJ; Two-component response regulator ORR29
TrEMBLA0A0D3FUG70.0A0A0D3FUG7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0P7N60.0A0A0E0P7N6_ORYRU; Uncharacterized protein
STRINGLOC_Os04g28130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1117845
MonocotsOGMP59202345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.13e-22response regulator 14
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]
  3. Tsai YC, et al.
    Characterization of genes involved in cytokinin signaling and metabolism from rice.
    Plant Physiol., 2012. 158(4): p. 1666-84
    [PMID:22383541]