PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g27410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 269aa    MW: 28917.1 Da    PI: 11.5783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g27410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54.1e-10174218347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ +  ++G+g+ ++I+r +   Rt+ q+ s+ qky
  LOC_Os04g27410.1 174 PWTEEEHRLFLLGLDKFGKGDLHSISRNFVISRTPTQVASHAQKY 218
                       7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.072167223IPR017930Myb domain
SuperFamilySSF466897.1E-16169224IPR009057Homeodomain-like
SMARTSM007173.7E-8171221IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.4E-15171221IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-7172217IPR009057Homeodomain-like
PfamPF002492.9E-8174218IPR001005SANT/Myb domain
CDDcd001671.02E-7174219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAEGADDGDG APGRSSPAVR VRGGARRPSE RGEELAGRPC AERSSHAVLA RGRSWSSPVI  60
GSSGGAVGVR VRGGARHLSA HGGGSGARRW SGAAAVGAGV RRPWATTTTT PPGRGREREI  120
RERGREEEEE KEREDDCPRL PVYTNAWRKS GGGGRYDGGK SCSKAEQERR KGIPWTEEEH  180
RLFLLGLDKF GKGDLHSISR NFVISRTPTQ VASHAQKYFI RLNSMNRDRR RSSIHDITSV  240
TAGDVAAQQG PITGQAKAAL RRRSGHRA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.153381e-139leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO248503021e-139
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g27410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g27410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8552270.0CR855227.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159H11-OSIGBa0137A07, complete sequence.
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6067290.0AL606729.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0062B06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ01HU90.0Q01HU9_ORYSA;
STRINGLOC_Os04g27410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MonocotsOGMP94663041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.14e-38MYB family protein