PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g09560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 148aa    MW: 16425.7 Da    PI: 8.4868
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g09560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR421.8e-135593240
               TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                      ++++C+C ks+C+k+YC Cf+a  +Cs++C+C++CkN+e
  LOC_Os04g09560.1 55 QHRSCRCVKSNCVKLYCPCFSAYGYCSQNCRCTNCKNRE 93
                      6789*********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-105495IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163418.01955147IPR005172CRC domain
PfamPF036381.4E-105793IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGQASISSSS SSPATATVAA FSPLRPPSAA SHTNQAVDMK VLRWLISARS MSNDQHRSCR  60
CVKSNCVKLY CPCFSAYGYC SQNCRCTNCK NREYYEDFVE ERVDMIKMKN PRAFDPKIVR  120
VQDASEIEPQ SSNAVPMPEV QVPRTFV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os04g09560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs04g09560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149601e-108AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL7315891e-108AL731589.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0039G19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633502.17e-60PREDICTED: protein tesmin/TSO1-like CXC 4
TrEMBLA0A0D3FSK85e-73A0A0D3FSK8_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g09560.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
MonocotsOGMP122672336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.14e-17Tesmin/TSO1-like CXC domain-containing protein