PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g62379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 219aa    MW: 25609.7 Da    PI: 4.3996
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g62379.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.14.6e-0966107144
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                       r +W++ E ++++++ +q+G++ ++ I + ++  ++++q++ ++
  LOC_Os03g62379.1  66 RAKWSKSETDKFYEGLQQFGSD-FAMIQHLFP-DKSRNQVRQKF 107
                       569*******************.*********.********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-1157113IPR009057Homeodomain-like
PfamPF159633.7E-2659140No hitNo description
SMARTSM007177.5E-965113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-666108IPR009057Homeodomain-like
CDDcd001673.35E-668108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MQAKPLGGCL DQTGTFRGNR LSTSQFGDMD DEYNEQDNWD NDRTENHVVE NTTKLNYHSY  60
MNRQTRAKWS KSETDKFYEG LQQFGSDFAM IQHLFPDKSR NQVRQKFKAE EKKHPMQVHD  120
AIMHRSRDNL YFKEVIKKLN IEDVQPDINN THEQEGTSNE EDPGNKNIPG GLINEEEENG  180
LDWSDKELDM HRSEVEEKEH VSTNDDDDDD LGDVFDWY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.790040.0leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10AV1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g62379.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g62379
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0968562e-92AC096856.7 Oryza sativa chromosome 3 BAC OSJNBa0075M12 genomic sequence, complete sequence.
GenBankAP0149592e-92AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633004.11e-141PREDICTED: uncharacterized protein LOC9267825
TrEMBLQ10AV11e-163Q10AV1_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g62379.11e-163(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1010535
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.15e-31MYB_related family protein