PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g62100.1
Common NameLOC107276546, OSJNBa0042I09.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 213aa    MW: 22952.8 Da    PI: 6.6007
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g62100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73e-09130174347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        W++eE+ + ++++++ G g+W+ I+ +    Rt+ q+ s+ qky
  LOC_Os03g62100.1 130 IWSEEEHRQCLRGIEEIGHGRWTQISIEYVPSRTPIQIASHTQKY 174
                       6*************************98888*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.3651774IPR017877Myb-like domain
SMARTSM0071722176IPR001005SANT/Myb domain
SuperFamilySSF466893.3E-62374IPR009057Homeodomain-like
CDDcd001675.24E-42470No hitNo description
Gene3DG3DSA:1.10.10.603.9E-52478IPR009057Homeodomain-like
PROSITE profilePS5129411.859123179IPR017930Myb domain
SuperFamilySSF466892.54E-14124180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-10127177IPR006447Myb domain, plants
SMARTSM007172.3E-5127177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-9129170IPR009057Homeodomain-like
PfamPF002491.2E-7130174IPR001005SANT/Myb domain
CDDcd001671.44E-6131170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGDLVGDGAA PAAAEPAPAA AACRWTRQKD KLLETLVARC AMNRQCVGGW DAIAAAFGDD  60
RTAAQVEQRY GEIAAEVRRV MEEPWDAEDP AIAAAAAAVP AAPVKHAAAG PGSDGGGEEG  120
KVVVEKKSGI WSEEEHRQCL RGIEEIGHGR WTQISIEYVP SRTPIQIASH TQKYFLRMAK  180
PKEDRKRKSI HDTPYHLHLP NAADAHAHQQ QQ*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ851L9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g62100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g62100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1044870.0AC104487.3 Oryza sativa chromosome 3 BAC OSJNBa0042I09 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629677.11e-154PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0E0P3M31e-154A0A0E0P3M3_ORYRU; Uncharacterized protein
TrEMBLA2XNT31e-154A2XNT3_ORYSI; Putative uncharacterized protein
TrEMBLQ851L91e-154Q851L9_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGLOC_Os03g62100.11e-153(Oryza sativa Japonica Group)
STRINGBGIOSGA009489-PA1e-153(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1818388
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-18MYB family protein