PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g61760.1
Common NameLOC4334685, Os03g0833300, OsJ_13251, OSJNBa0078D06.37, OSJNBa0096I06.31, SPL6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 970aa    MW: 105604 Da    PI: 5.2792
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g61760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.5e-41151228178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC+adl+ +++yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  LOC_Os03g61760.1 151 ACQVEGCTADLTGVRDYHRRHKVCEMHAKATTAVVGNTVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRP 228
                       5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-34145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-38150230IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.13E-8750856IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.9E-7754859IPR020683Ankyrin repeat-containing domain
CDDcd002045.20E-8756856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 970 aa     Download sequence    Send to blast
MEAARVGAQS RHLYGGGLGE PDMDRRDKRL FGWDLNDWRW DSDRFVATPV PAAEASGLAL  60
NSSPSSSEEA GAASVRNVNA RGDSDKRKRV VVIDDDDVED DELVENGGGS LSLRIGGDAV  120
AHGAGVGGGA DEEDRNGKKI RVQGGSPSGP ACQVEGCTAD LTGVRDYHRR HKVCEMHAKA  180
TTAVVGNTVQ RFCQQCSRFH PLQEFDEGKR SCRRRLAGHN RRRRKTRPEV AVGGSAFTED  240
KISSYLLLGL LGVCANLNAD NAEHLRGQEL ISGLLRNLGA VAKSLDPKEL CKLLEACQSM  300
QDGSNAGTSE TANALVNTAV AEAAGPSNSK MPFVNGDQCG LASSSVVPVQ SKSPTVATPD  360
PPACKFKDFD LNDTYGGMEG FEDGYEGSPT PAFKTTDSPN CPSWMHQDST QSPPQTSGNS  420
DSTSAQSLSS SNGDAQCRTD KIVFKLFEKV PSDLPPVLRS QILGWLSSSP TDIESYIRPG  480
CIILTVYLRL VESAWKELSD NMSSYLDKLL NSSTGNFWAS GLVFVMVRHQ IAFMHNGQLM  540
LDRPLANSAH HYCKILCVRP IAAPFSTKVN FRVEGLNLVS DSSRLICSFE GSCIFQEDTD  600
NIVDDVEHDD IEYLNFCCPL PSSRGRGFVE VEDGGFSNGF FPFIIAEQDI CSEVCELESI  660
FESSSHEQAD DDNARNQALE FLNELGWLLH RANIISKQDK VPLASFNIWR FRNLGIFAME  720
REWCAVTKLL LDFLFTGLVD IGSQSPEEVV LSENLLHAAV RMKSAQMVRF LLGYKPNESL  780
KRTAETFLFR PDAQGPSKFT PLHIAAATDD AEDVLDALTN DPGLVGINTW RNARDGAGFT  840
PEDYARQRGN DAYLNMVEKK INKHLGKGHV VLGVPSSIHP VITDGVKPGE VSLEIGMTVP  900
PPAPSCNACS RQALMYPNST ARTFLYRPAM LTVMGIAVIC VCVGLLLHTC PKVYAAPTFR  960
WELLERGPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-31145225484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1777782ESLKRT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.591970.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329798710.0
Expression AtlasQ75LH6-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g61760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g61760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698470.0AK069847.1 Oryza sativa Japonica Group cDNA clone:J023034C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631511.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A0E0P3J00.0A0A0E0P3J0_ORYRU; Uncharacterized protein
STRINGLOC_Os03g61760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25951432
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]