PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g60630.1
Common NameOJ1754_E06.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 356aa    MW: 35104 Da    PI: 9.7068
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g60630.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.8e-3955115262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  LOC_Os03g60630.1  55 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 115
                       56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3742113IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3259113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60959113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MPPHHGGLMA PRPDMVAAAV AASGGGGGGG GPTGGTAVRP GSMTERARLA KIPQPEPGLK  60
CPRCESTNTK FCYFNNYSLS QPRHFCKTCR RYWTRGGALR NVPVGGGCRR NKRTKSSKSS  120
SSTSAAGSAS ATGGTSSSTS STATGGSSSA AAAAAMMPPQ AQLPFLASLH HPLGGGDHYS  180
SGASRLGFPG LSSLDPVDYQ LGGGAAAAAA IGLEQWRLPQ IQQFPFLSRN DAMPPPMSGI  240
YPFDAEAAAD AAGFAGQLLA GTKVPGSSGL ITQLASVKME DSNAQSAAMN SSPREFLGLP  300
GNLQFWGGGN GAGPGGNGDG ATGGSGAGVA PGGGGSGGGW ADLSGFNSSS SGNIL*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84T97
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g60630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g60630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044330.0AC104433.8 Oryza sativa chromosome 3 BAC OJ1754_E06 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628806.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X1
RefseqXP_015628807.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X2
TrEMBLQ84T970.0Q84T97_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os03g60630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.13e-41OBF-binding protein 3