PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g60080.1
Common NameLOC4334553, NAC, Os03g0815100, OsJ_13092, OSJNBa0024F18.3, OSNPB_030815100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 317aa    MW: 35177.8 Da    PI: 7.1466
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g60080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52171421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtd+elv +yL++k++g++l++  +i+evd+yk++PwdLp+++  + +ewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v 
  LOC_Os03g60080.1  17 LPPGFRFHPTDDELVEHYLCRKAAGQRLPV-PIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVA 108
                       79****************************.88***************8777899*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +g++ g+kk Lvfy g+ap+g+ktdW+mheyrl
  LOC_Os03g60080.1 109 P-RGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRL 142
                       9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6511170IPR003441NAC domain
PROSITE profilePS5100560.37717170IPR003441NAC domain
PfamPF023653.1E-2718142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGMGMRRERD AEAELNLPPG FRFHPTDDEL VEHYLCRKAA GQRLPVPIIA EVDLYKFDPW  60
DLPERALFGA REWYFFTPRD RKYPNGSRPN RAAGNGYWKA TGADKPVAPR GRTLGIKKAL  120
VFYAGKAPRG VKTDWIMHEY RLADAGRAAA GAKKGSLRLD DWVLCRLYNK KNEWEKMQQG  180
KEVKEEASDM VTSQSHSHTH SWGETRTPES EIVDNDPFPE LDSFPAFQPA PPPATAMMVP  240
KKESMDDATA AAAAAATIPR NNSSLFVDLS YDDIQGMYSG LDMLPPGDDF YSSLFASPRV  300
KGTTPRAGAG MGMVPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-12731761174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.266950.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ75HE5
Function -- GeneRIF ? help Back to Top
  1. OsNAC6 is a key component of the OsHDAC1 regulon, and mediates the alteration of root development in OsHDAC1OE seedlings.
    [PMID: 19453457]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g60080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g60080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5968080.0AY596808.1 Oryza sativa (japonica cultivar-group) NAC transcription factor (NAC) mRNA, complete cds.
GenBankAK1047120.0AK104712.1 Oryza sativa Japonica Group cDNA clone:001-037-H04, full insert sequence.
GenBankAK1045510.0AK104551.1 Oryza sativa Japonica Group cDNA clone:006-305-E06, full insert sequence.
GenBankAK0992450.0AK099245.1 Oryza sativa Japonica Group cDNA clone:J013116P10, full insert sequence.
GenBankAK0676900.0AK067690.1 Oryza sativa Japonica Group cDNA clone:J013120D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630558.10.0PREDICTED: NAC domain-containing protein 67-like
SwissprotQ7EZT11e-113NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0K0KVC60.0A0A0K0KVC6_ORYRU; SNAC1 protein
TrEMBLA0A0K0KVC90.0A0A0K0KVC9_ORYSI; SNAC1 protein
TrEMBLA0A0K0KVM80.0A0A0K0KVM8_ORYNI; SNAC1 protein
TrEMBLQ75HE50.0Q75HE5_ORYSJ; NAC transcription factor
STRINGLOC_Os03g60080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-80NAC family protein
Publications ? help Back to Top
  1. Hu H, et al.
    Overexpressing a NAM, ATAF, and CUC (NAC) transcription factor enhances drought resistance and salt tolerance in rice.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(35): p. 12987-92
    [PMID:16924117]
  2. Chung PJ, et al.
    The histone deacetylase OsHDAC1 epigenetically regulates the OsNAC6 gene that controls seedling root growth in rice.
    Plant J., 2009. 59(5): p. 764-76
    [PMID:19453457]