PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g59730.1
Common NameOSJNBb0033J23.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 497aa    MW: 53563.9 Da    PI: 8.5555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g59730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM86.36e-272764093128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknr...atksgyWkatg 87 
                       pG+rF Ptd+el+ ++Lk+k + ++ ++++ + ik++d++k++  +L+      k+ +  wy Fs+r++ +++g r+ r   +t+ gyWk+  
  LOC_Os03g59730.1 276 PGVRFTPTDQELIIHFLKPKYNLRDaMPTNIIvIKQLDVCKLNLDELHGdlgLGKSLDGAWYVFSPRSRYKERGVRPARgikTTAVGYWKSNS 368
                       9*******************9988875554445**************9534322334459*****************996534779******* PP

               NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        + +v++ +ge++g  ++L++  g++p+g+ t+W m+eyr+
  LOC_Os03g59730.1 369 AEADVVDDDGEVIGRVNSLTLALGHQPRGKATHWRMKEYRI 409
                       ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.442274452IPR003441NAC domain
SuperFamilySSF1019412.09E-30275451IPR003441NAC domain
PfamPF023654.8E-15276409IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MAAINPVAGE VAAATAKAPP PAMATVRAPL PANHYSPYHS ASAAGSYAAN TQSTSSPVSP  60
ASPAMISSSS SSLPPQQQRT WQPQPTTFSQ ANPGHAYQQD HLPAVAGRRF FPPPAMQMQY  120
YHQQPDGVAM VGSGHPMAAP VHSSPLATTS GSNHAVVPDA PPQEPAKRRR RNTAAAATAR  180
RGRGRPRGAT ASSAHSAPPP PQQQQQPTTS APAITAQRND DVNQEDDNQS SKNSAEEAVV  240
VDGGEPPAAT SALAIVPRHG DVGDADRPVS PYSDIPGVRF TPTDQELIIH FLKPKYNLRD  300
AMPTNIIVIK QLDVCKLNLD ELHGDLGLGK SLDGAWYVFS PRSRYKERGV RPARGIKTTA  360
VGYWKSNSAE ADVVDDDGEV IGRVNSLTLA LGHQPRGKAT HWRMKEYRIP QFQIPLGQED  420
SNRLLTPMLS QDIVLFYFLQ LDEWVLCKLY HSFAYKQKGK CKVHEEGSKS DRGVQDLSID  480
DDRKTCDIEA NKPNGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-172594583171NAC domain-containing protein 19
4dul_A1e-172594583171NAC domain-containing protein 19
1ut7_B1e-172594583171NO APICAL MERISTEM PROTEIN
1ut7_A1e-172594583171NO APICAL MERISTEM PROTEIN
1ut4_B1e-172594583171NO APICAL MERISTEM PROTEIN
1ut4_A1e-172594583171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XZG3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g59730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g59730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375070.0AC137507.3 Oryza sativa chromosome 3 BAC OSJNBb0033J23 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ7XZG30.0Q7XZG3_ORYSJ; No apical meristem protein
STRINGLOC_Os03g59730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1390234
MonocotsOGMP131302130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-23NAC domain containing protein 25