PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g57670.1
Common NameOsJ_12898, OSJNBa0087O09.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 172aa    MW: 18322.4 Da    PI: 7.7749
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g57670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.77.1e-37211211101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+C++dCvlap+fpa++p+++a+v+++FGa n  ++l++lp +er +a++s++ eA  r++dPvyG++gvi++lq q++ ++ e
  LOC_Os03g57670.1  21 RCAACKFLRRRCSRDCVLAPHFPASDPHRYACVQRVFGAGNTARMLQQLPVQERGRAADSMAAEAYRRVQDPVYGCAGVINRLQDQIRAAQCE 113
                       6******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       la +++++
  LOC_Os03g57670.1 114 LAWTHAQI 121
                       ***99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.76320121IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3521117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSPGEEDVEA SSDSGGSATR RCAACKFLRR RCSRDCVLAP HFPASDPHRY ACVQRVFGAG  60
NTARMLQQLP VQERGRAADS MAAEAYRRVQ DPVYGCAGVI NRLQDQIRAA QCELAWTHAQ  120
IAMHSAAAAH ARTTLPPGQR DGGGGGAPST QQATTSAAWQ LEDFASEFSF P*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ852M3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g57670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g57670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126111e-178CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC0870961e-178AC087096.11 Oryza sativa chromosome 3 BAC OSJNBa0087O09 genomic sequence, complete sequence.
GenBankAP0149591e-178AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690105.11e-67PREDICTED: LOB domain-containing protein 24-like
SwissprotP594687e-43LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA2XMS11e-123A2XMS1_ORYSI; Putative uncharacterized protein
TrEMBLQ852M31e-123Q852M3_ORYSJ; LOB domain protein 4, putative
STRINGBGIOSGA013705-PA1e-123(Oryza sativa Indica Group)
STRINGLOC_Os03g57670.11e-123(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-41LOB domain-containing protein 24