PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g56630.2
Common NameLOC4334298, OsJ_12791, OSJNBa0010I09.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 799aa    MW: 91294.6 Da    PI: 6.7587
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g56630.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR176.64.8e-2426111290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +Y +YA +vGFsvrk   +k+ +n+ +++r +vCskeg+r+++ ++  + +++r+etrtgC a++++k + +gk++vt+ + +HnH+l 
  LOC_Os03g56630.2  26 CYVTYAGTVGFSVRKGWLEKTATNT-TKSRAYVCSKEGFRSKSVST--DPKKPRPETRTGCLAHMTIKITVSGKYVVTEYVADHNHDLE 111
                       7*******************96666.99**************9988..999************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-2126111IPR004330FAR1 DNA binding domain
PfamPF105511.4E-24211305IPR018289MULE transposase domain
PROSITE profilePS5096610.546480527IPR007527Zinc finger, SWIM-type
PfamPF044341.6E-7480525IPR007527Zinc finger, SWIM-type
SMARTSM005751.5E-8502529IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MEVVAGPGGE PKVGMVFLNE DKAYDCYVTY AGTVGFSVRK GWLEKTATNT TKSRAYVCSK  60
EGFRSKSVST DPKKPRPETR TGCLAHMTIK ITVSGKYVVT EYVADHNHDL ETPLVDIQVL  120
RSHKLLAKLQ QPPDPPRVVL IPNDYKNYVR TRHTKDMQLG DTQAIYEYLQ RKKGEHPSFF  180
YAIQVDEDDQ LTNVFWADVK SILDYHYFGD VLCVDTRYST SDHSRPLLLF IGVNHHKQPV  240
IFGAALVYDE SVESFKWLFE TFKSAMSGKQ PKTVMIDQST AISEAVASVW PRTTQRFSLI  300
HLYKNATKIL RDAFQASETF ADDFSMWLYG YEEEGDFLSS WEILSDKYNL KDNEWLGKLY  360
ADRERWALPY GRDSFCADIA AALRSDNNTD AILADLLKKE TDFPSFFNNY DKLLENKRLA  420
EQQADYLGVQ MAQRVAPLRM LWQAANAYTP TLFEMFRLEF ELTLTCMAYC CGEIGPISEY  480
EVTVKNRPRD HFVRFDSSEC MVVCSCKKFE FTGIPCCHVL KVLEVRNIKE LPPHYILKRW  540
RKDAQSESPR ENYGFEAVDE DPRFLLSKRY SMLYRTFYKI AAKAAENIEA YTYMESQCDQ  600
FIEQVELLLQ AKLHDKSSLS TILKVQQPNL FPNEASNSET RRVSSKKIKN VDTRRQQQSP  660
LQSNKKKKGR QGLPEPEEAE VPLRVDPPTI SNDIPNHLRT PTSQFLATSH IMQAPYIAQQ  720
FGLSSLQGFP GISPFGQEPA PAPLQQPHLQ QPPFHSGPQI PQAPPPDIQS LQFLSSNPQL  780
GHQATDQSQY TIPVWDFL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.74010.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379900830.0
Expression AtlasQ8S7I2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g56630.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g56630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1204600.0AK120460.1 Oryza sativa Japonica Group cDNA clone:J013106N05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630921.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4 isoform X2
TrEMBLQ8S7I20.0Q8S7I2_ORYSJ; Putative transposase
STRINGLOC_Os03g56630.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-109FAR1-related sequence 5