PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g56140.2
Common NameLOC9271080, Os03g0772100, OsJ_012214, OSJNBb0094O03.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 348aa    MW: 37007.5 Da    PI: 6.723
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g56140.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.7e-102522891855
                       HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       ++ k +yps+ e+  LA+ +gL+++q+++WF N+R ++
  LOC_Os03g56140.2 252 HYDKWPYPSEVEKMTLAQTTGLDQKQISNWFINQRKRH 289
                       68889******************************885 PP

2ELK271e-09208229122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       +LKhqLl KY+g+Lg+L+q Fs
  LOC_Os03g56140.2 208 QLKHQLLMKYGGSLGDLRQAFS 229
                       59*****************776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.5E-2079123IPR005540KNOX1
PfamPF037901.4E-1980119IPR005540KNOX1
SMARTSM011884.7E-5208229IPR005539ELK domain
PROSITE profilePS512139.097208228IPR005539ELK domain
PfamPF037893.3E-9208229IPR005539ELK domain
PROSITE profilePS5007111.936228292IPR001356Homeobox domain
SuperFamilySSF466898.98E-16230298IPR009057Homeodomain-like
SMARTSM003894.5E-11230296IPR001356Homeobox domain
CDDcd000864.76E-13231292No hitNo description
Gene3DG3DSA:1.10.10.604.9E-24233292IPR009057Homeodomain-like
PfamPF059201.9E-15248288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MESFASLAGG GSSSTTARLP ELIPPENPDR ISPPPLLYQL LAGSASSARH GHGHHHGGGG  60
GAAAAAVQGL QVSPAGAEAA MKAEIMSHPQ YSALLAAYLG CKKVGAPPDV LTKLTAVPAA  120
QQQLDAADGH PRRRHEPRRD DDVPDHQLDQ FMHADEVQGG AGAADPGSRG VLQLDSIADS  180
NCEGTGSSEE EQDTSCPEAE EIDPSDKQLK HQLLMKYGGS LGDLRQAFSK RTKKGKLPKE  240
ARLKLLHWWE LHYDKWPYPS EVEKMTLAQT TGLDQKQISN WFINQRKRHW KPTPVAGMTF  300
PTVEAAGGGF RHSGHDGGLA AAAAAAALPL YMGSWPFVVD GMYRLGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.607410.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977225840.0
Expression AtlasQ10EC6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g56140.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g56140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288840.0AB028884.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH43, complete cds.
GenBankAK1072960.0AK107296.1 Oryza sativa Japonica Group cDNA clone:002-126-C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630164.10.0PREDICTED: homeobox protein knotted-1-like 9
SwissprotQ10EC60.0KNOS9_ORYSJ; Homeobox protein knotted-1-like 9
TrEMBLB9F5X50.0B9F5X5_ORYSJ; Uncharacterized protein
STRINGLOC_Os03g56140.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.19e-52KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]