PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g56110.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 337aa    MW: 36673.2 Da    PI: 7.0872
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g56110.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092482822155
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       k +yps+ e+  LA+ +gL+++q+ +WF N+R ++
  LOC_Os03g56110.2 248 KWPYPSEMEKMTLAQTTGLDQKQINNWFINQRKRH 282
                       569*****************************885 PP

2ELK37.64.6e-13202223122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       +LKhqLlrKY+g+Lg+L+q Fs
  LOC_Os03g56110.2 202 QLKHQLLRKYGGSLGDLRQVFS 223
                       59*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.4E-1981125IPR005540KNOX1
PfamPF037904.5E-1982121IPR005540KNOX1
SMARTSM012568.3E-26136188IPR005541KNOX2
PfamPF037911.4E-18146186IPR005541KNOX2
PfamPF037892.8E-8202220IPR005539ELK domain
SMARTSM011882.3E-5202223IPR005539ELK domain
PROSITE profilePS512139.324202222IPR005539ELK domain
PROSITE profilePS5007112.503222285IPR001356Homeobox domain
SMARTSM003891.2E-11224289IPR001356Homeobox domain
SuperFamilySSF466892.05E-18224289IPR009057Homeodomain-like
CDDcd000861.39E-13225285No hitNo description
Gene3DG3DSA:1.10.10.609.2E-27227285IPR009057Homeodomain-like
PfamPF059206.6E-17242281IPR008422Homeobox KN domain
PROSITE patternPS000270260283IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MESFASLAGG GSSSTTARLP ELISPENPDH ISPPPLLYQL LAGPESSARQ HGHDGHHHGG  60
GGGEAAAAAV QGQVSPAGAE AAVKAEIMSH PQYSALLAAY LGCKKVGAPP DVLTKLTAVP  120
AAQQLDEADG HPRRRHEPQR DDDPDQLDQF MDAYCSMLTR YREELERPIL EAAEFFSRVE  180
TQLDSLAGTG SSEEEQDPSD KQLKHQLLRK YGGSLGDLRQ VFSKRTKKGK LPKEARQKLL  240
HWWELHYKWP YPSEMEKMTL AQTTGLDQKQ INNWFINQRK RHWKPTPVAG TAFPTMEAAG  300
GGFRHSGHGG GLAAAAALPL YMGRPFVVDG MYRLGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575510.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO51037260.0
Expression AtlasB7F078-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g56110.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g56110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1072960.0AK107296.1 Oryza sativa Japonica Group cDNA clone:002-126-C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628326.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X2
SwissprotQ10ED20.0KNOS8_ORYSJ; Homeobox protein knotted-1-like 8
TrEMBLB7F0780.0B7F078_ORYSJ; cDNA clone:002-126-C04, full insert sequence
STRINGLOC_Os03g56110.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-66KNOTTED-like from Arabidopsis thaliana