PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g56110.1
Common NameOs03g0771500, OSH43, OSJNBa0072F13.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 342aa    MW: 37235.8 Da    PI: 6.7998
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g56110.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092532872155
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       k +yps+ e+  LA+ +gL+++q+ +WF N+R ++
  LOC_Os03g56110.1 253 KWPYPSEMEKMTLAQTTGLDQKQINNWFINQRKRH 287
                       569*****************************885 PP

2ELK37.64.7e-13207228122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       +LKhqLlrKY+g+Lg+L+q Fs
  LOC_Os03g56110.1 207 QLKHQLLRKYGGSLGDLRQVFS 228
                       59*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.4E-1981125IPR005540KNOX1
PfamPF037904.6E-1982121IPR005540KNOX1
SMARTSM012561.2E-24136188IPR005541KNOX2
PfamPF037911.4E-18146186IPR005541KNOX2
SMARTSM011882.3E-5207228IPR005539ELK domain
PfamPF037892.8E-8207225IPR005539ELK domain
PROSITE profilePS512139.324207227IPR005539ELK domain
PROSITE profilePS5007112.503227290IPR001356Homeobox domain
SMARTSM003891.2E-11229294IPR001356Homeobox domain
SuperFamilySSF466892.14E-18229294IPR009057Homeodomain-like
CDDcd000861.44E-13230290No hitNo description
Gene3DG3DSA:1.10.10.609.4E-27232290IPR009057Homeodomain-like
PfamPF059206.7E-17247286IPR008422Homeobox KN domain
PROSITE patternPS000270265288IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MESFASLAGG GSSSTTARLP ELISPENPDH ISPPPLLYQL LAGPESSARQ HGHDGHHHGG  60
GGGEAAAAAV QGQVSPAGAE AAVKAEIMSH PQYSALLAAY LGCKKVGAPP DVLTKLTAVP  120
AAQQLDEADG HPRRRHEPQR DDDPDQLDQF MDAYCSMLTR YREELERPIL EAAEFFSRVE  180
TQLDSLAESN CEGTGSSEEE QDPSDKQLKH QLLRKYGGSL GDLRQVFSKR TKKGKLPKEA  240
RQKLLHWWEL HYKWPYPSEM EKMTLAQTTG LDQKQINNWF INQRKRHWKP TPVAGTAFPT  300
MEAAGGGFRH SGHGGGLAAA AALPLYMGRP FVVDGMYRLG S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575510.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO51037260.0
Expression AtlasQ10ED2-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, mainly expressed in the basal and central parts of the ventral side of the embryo, in cells just below the coleoptile, and corresponding to the epiblast and part of the shoot region. At the shoot apex differentiation stage, expressed in the shoot apical meristem (SAM) and the epiblast, but not in the region between the SAM and epiblast. Expressed also in the cells surrounding the ventral side of the root apical meristem. Expression pattern is maintained in subsequent stages after the second leaf primordium is formed. During inflorescence development, expressed only in the corpus of the rachis primordium, but not in the tunica layer (L1). After floral induction, expressed in both tunica and corpus, but not in floral organ primordia. Later in flower development, expression in the corpus of the floral meristem disappears. {ECO:0000269|PubMed:10488233}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10488233}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g56110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g56110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288840.0AB028884.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH43, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628321.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628323.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628324.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
RefseqXP_015628325.10.0PREDICTED: homeobox protein knotted-1-like 8 isoform X1
SwissprotQ10ED20.0KNOS8_ORYSJ; Homeobox protein knotted-1-like 8
TrEMBLB9F5X40.0B9F5X4_ORYSJ; Uncharacterized protein
STRINGLOC_Os03g56110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP147561321
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-68KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Sentoku N, et al.
    Regional expression of the rice KN1-type homeobox gene family during embryo, shoot, and flower development.
    Plant Cell, 1999. 11(9): p. 1651-64
    [PMID:10488233]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]