PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55760.1
Common NameLOC4334229, Os03g0766500, OSNPB_030766500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 393aa    MW: 40222.3 Da    PI: 6.9585
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32121174255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LOC_Os03g55760.1 121 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 174
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.53E-16118175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28119175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23121174IPR006447Myb domain, plants
PfamPF002496.2E-8122173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MLQRNLPNLS LRISPPAVSS AAAPVSSGTP TTAARTTLPT GVITDAEGGG EVAAFFGNPS  60
SGSEPPGLSL GLGPTTPAHA DAGGGRHGDH HLQPQGCAPF KRAAARASQL PAGSKRSVRA  120
PRMRWTTALH ARFVHAVELL GGHERATPKS VLELMNVKDL TLAHVKSHLQ MYRTVKSTDR  180
SSHIASGEAQ LQQQAGMEVA MEAAAGGGGN GGGGGGGVVL PMMPACDDMV GICSSPAPPA  240
AATSSAAAYF LCATTTSTAT APLAVVPSPP APTIPTRRTD QTPALEKGVA IVDSLHRCQK  300
HNYSPVLQDA LHQGAEEDHL ITGNLPMGGA SAQASIEAMA TTNSSSPASS SPSLASLEQL  360
LPEDSFAPNL EISLGRHNWN MDHPEELSLK YL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.556080.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329936170.0
Expression AtlasQ10EL0-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084080.0AK108408.1 Oryza sativa Japonica Group cDNA clone:002-142-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629095.10.0PREDICTED: transcription factor LUX
TrEMBLQ10EL00.0Q10EL0_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os03g55760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-39G2-like family protein