PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55610.1
Common NameLOC4334219, Os03g0764900, OSNPB_030764900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 360aa    MW: 36697.5 Da    PI: 9.6458
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-3876133360
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  LOC_Os03g55610.1  76 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 133
                       66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.8E-3278132IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-2679128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MIQELLGGTT MDQLKGASAL NHASLPVVLQ PIVSNPSPTS SSSTSSRSSA QATQQRSSSA  60
TSSPHGQGQG GGAAEQAPLR CPRCNSSNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR  120
NVPIGGGCRK PRPMPAPVAK PPMSCKAAPP LGLGGGPVSW ASGQQAATAH LMALLNSARG  180
VQGHGGSNVH RLLGLDTMGH LQILPGAPNG AGAGTAASLW PQSAPRPVTP PPPHMDSQLG  240
MGTLGHHDVL SSLGLKLPSS ASSSPAASYY SDQLHAVVSN AGRPQAPYDV ATASLPCTTA  300
VTSLPSALSS VSAAAPTSNT VGMDLPPVSL AAPEMQYWNG PAAMSVPWPD LPTPNGAFP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.103280.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329733980.0
Expression AtlasQ10EQ1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0990430.0AC099043.6 Oryza sativa chromosome 3 BAC OSJNBa0079B15 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK0633800.0AK063380.1 Oryza sativa Japonica Group cDNA clone:001-114-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629418.10.0PREDICTED: uncharacterized protein LOC4334219
TrEMBLI1PFT10.0I1PFT1_ORYGL; Uncharacterized protein
TrEMBLQ10EQ10.0Q10EQ1_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os03g55610.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0322700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-30Dof family protein