PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55590.1
Common NameLOC4334216, Os03g0764600, OSJNBa0079B15.28, OSNPB_030764600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 349aa    MW: 37300 Da    PI: 7.506
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32224279156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k r++W+peLH++Fv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  LOC_Os03g55590.1 224 KSRRCWSPELHRQFVAALQQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 279
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.681221281IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-28222282IPR009057Homeodomain-like
SuperFamilySSF466895.82E-17222282IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26224279IPR006447Myb domain, plants
PfamPF002495.9E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGLDVGEIGM GLDLSLDLKM FAARSAVRMA AAAAKEATGV EACIRSLEEE RRKIEMFRRE  60
LPLCARLLAD VIELMKEEAG KRRKDGDDAE AKAEDGDKTK WMSTAQLWVD SRGSDADSEN  120
DRRSGSTSPA SRLLGGAEES SSRAVAPPPY FRREERVVLR PAMPLLPPAS HRSPPPAAAA  180
AATAAGDDHR HVVASSFATA VPSPVPAALS LQAQAQQQQQ QARKSRRCWS PELHRQFVAA  240
LQQLGGPQVA TPKQIREVMK VDGLTNDEVK SHLQKYRLHN RKSPGTASAS HSIVLVGDLW  300
ASQEVSCSQS GSPQGPLQLS GSGVAVSAAT AGDSCCEDDD KSEGYVRK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.254530.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329908340.0
Expression AtlasQ7Y0B7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1056250.0AK105625.1 Oryza sativa Japonica Group cDNA clone:001-200-C11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631206.10.0PREDICTED: uncharacterized protein LOC4334216
TrEMBLA0A0E0P1Q10.0A0A0E0P1Q1_ORYRU; Uncharacterized protein
TrEMBLB8AKI10.0B8AKI1_ORYSI; Putative uncharacterized protein
TrEMBLI1PFS90.0I1PFS9_ORYGL; Uncharacterized protein
TrEMBLQ7Y0B70.0Q7Y0B7_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os03g55590.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA013620-PA0.0(Oryza sativa Indica Group)
STRINGORGLA10G0167800.10.0(Oryza glaberrima)
STRINGORGLA03G0322500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25631133
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-40G2-like family protein