PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55164.2
Common NameOs03g0758900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 440aa    MW: 46369.5 Da    PI: 6.6758
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55164.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.19e-29194250259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+ k++e prsYY+Ct  gCpvkk vers+ d+ + eitY+g+H h+
  LOC_Os03g55164.2 194 KDGYNWRKYGQKQLKDAESPRSYYKCTRDGCPVKKIVERSS-DGCIKEITYKGRHSHP 250
                       8****************************************.***************8 PP

2WRKY103.31.3e-32339397159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg++ prsYY+Ct  gC+v+k++er++ dpk+v +tY+g+Hnh+
  LOC_Os03g55164.2 339 LDDGYRWRKYGQKVVKGNPRPRSYYKCTADGCNVRKQIERASADPKCVLTTYTGRHNHD 397
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.768188252IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-26189252IPR003657WRKY domain
SuperFamilySSF1182903.4E-23192252IPR003657WRKY domain
SMARTSM007749.8E-31193251IPR003657WRKY domain
PfamPF031064.5E-22194250IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-34324399IPR003657WRKY domain
SuperFamilySSF1182904.84E-28331399IPR003657WRKY domain
PROSITE profilePS5081136.059334399IPR003657WRKY domain
SMARTSM007744.4E-36339398IPR003657WRKY domain
PfamPF031062.4E-24340397IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MADRRRSDGG GGMQQQPFTS PGQERVFDGG GVPGQVAAPY GSDFDQSSYM ALLAAGAVGV  60
GVGVQPTAAP WAVEEDVAAA PPGISLAPQF SMANYAPPPS YQHPATLVSP PLAAGLHPYP  120
PYLHGVDAPP PQWPPRPAPP PSFSVLDLAA AAAPHEQRHS MQQLLLRAAA FGGGMHAAAA  180
PAPAAAAAIE QPAKDGYNWR KYGQKQLKDA ESPRSYYKCT RDGCPVKKIV ERSSDGCIKE  240
ITYKGRHSHP RPVEPRRGGA ASSSSSAMAA GTDHNAGAAA DDAAAADEDD PSDDDDTLLH  300
EDDDDGEEGH DRGVDGEVGQ RVVRKPKIIL QTRSEVDLLD DGYRWRKYGQ KVVKGNPRPR  360
SYYKCTADGC NVRKQIERAS ADPKCVLTTY TGRHNHDPPG RPPAAANLQM PGPAAMRLAG  420
GGTAHQQPSG GAHQMKEET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-34195399877Probable WRKY transcription factor 4
2lex_A8e-34195399877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.582850.0leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191910.0
Expression AtlasQ7XAA5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55164.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55164
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418520.0AY341852.1 Oryza sativa (japonica cultivar-group) WRKY11 mRNA, complete cds.
GenBankAY3418480.0AY341848.1 Oryza sativa (japonica cultivar-group) WRKY7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630965.10.0PREDICTED: probable WRKY transcription factor 58
TrEMBLQ7XAA50.0Q7XAA5_ORYSJ; Os03g0758900 protein
STRINGLOC_Os03g55164.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.19e-37WRKY DNA-binding protein 4