PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55164.1
Common NameOs03g0758900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 1003aa    MW: 109042 Da    PI: 7.1612
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55164.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.52.7e-28757813259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+ k++e prsYY+Ct  gCpvkk vers+ d+ + eitY+g+H h+
  LOC_Os03g55164.1 757 KDGYNWRKYGQKQLKDAESPRSYYKCTRDGCPVKKIVERSS-DGCIKEITYKGRHSHP 813
                       8****************************************.***************7 PP

2WRKY101.83.9e-32902960159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg++ prsYY+Ct  gC+v+k++er++ dpk+v +tY+g+Hnh+
  LOC_Os03g55164.1 902 LDDGYRWRKYGQKVVKGNPRPRSYYKCTADGCNVRKQIERASADPKCVLTTYTGRHNHD 960
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.128.201.2E-24125286IPR012674Calycin
SuperFamilySSF508141.62E-12126202IPR011038Calycin-like
SuperFamilySSF508141.62E-12229286IPR011038Calycin-like
PfamPF122048.7E-13257438IPR022017Domain of unknown function DUF3598
SuperFamilySSF508143.29E-30301443IPR011038Calycin-like
Gene3DG3DSA:2.40.128.207.3E-43302443IPR012674Calycin
PROSITE profilePS5081122.768751815IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-26752815IPR003657WRKY domain
SuperFamilySSF1182901.05E-22755815IPR003657WRKY domain
SMARTSM007749.8E-31756814IPR003657WRKY domain
PfamPF031061.3E-21757813IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.6E-34887962IPR003657WRKY domain
SuperFamilySSF1182901.57E-27894962IPR003657WRKY domain
PROSITE profilePS5081136.059897962IPR003657WRKY domain
SMARTSM007744.4E-36902961IPR003657WRKY domain
PfamPF031067.2E-24903960IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MAEALVAVLR LAASAAATAR PQSRSGRHGS CAARVPCPGP SPFRRGRLCA RAAVAGPPEV  60
DDDDAMTIDN LRRFFDVNVG KWNGAFYFFF FFFFFFFFFF SGFVVCKTET LSVLVRVPVC  120
LCSSRQQFDA HGRVLQGIST RLSVSTYGED DLISLLQSLY IKQASSQISF VDEEDSEEWV  180
EYKIKETNMF TVDKYQQVGF FQEEKAFALR YQTAGMLETV LRAGVLGEDD TGEESPKNLK  240
IPSRKPSIVC ENCLYSREGN GRVRAFHIMD PKGVLDMLII FHEKQGSEVP LMYSSDDADI  300
TNSDRIAPLL GRWEGRSVTK RSGVYGATLS EADTVVLLEK DRNGQLILDN MSTKSGSSTT  360
TTVHWTGSAN NNLLQFDGGY EMTLLPGGMY MGYPTDIGKI VNDMDSFHLE FCWMESPGKR  420
QRLVRTYDSA GLAVSSTYFF ETKRLSSLKP HHHLRRRVGD HGRTPDLSNA NRVAGEGEGG  480
DRFRRRRVAA VTAAAIDRAK SPEEGDSFRW FWKYSAQAVG ASQSNPNTSR SDPLSWSAAV  540
VVIDREALPL HKQRKLTRAA AVAMADRRRS DGGGGMQQQP FTSPGQERVF DGGGVPGQVA  600
APYGSDFDQS SYMALLAAGA VGVGVGVQPT AAPWAVEEDV AAAPPGISLA PQFSMANYAP  660
PPSYQHPATL VSPPLAAGLH PYPPYLHGVD APPPQWPPRP APPPSFSVLD LAAAAAPHEQ  720
RHSMQQLLLR AAAFGGGMHA AAAPAPAAAA AIEQPAKDGY NWRKYGQKQL KDAESPRSYY  780
KCTRDGCPVK KIVERSSDGC IKEITYKGRH SHPRPVEPRR GGAASSSSSA MAAGTDHNAG  840
AAADDAAAAD EDDPSDDDDT LLHEDDDDGE EGHDRGVDGE VGQRVVRKPK IILQTRSEVD  900
LLDDGYRWRK YGQKVVKGNP RPRSYYKCTA DGCNVRKQIE RASADPKCVL TTYTGRHNHD  960
PPGRPPAAAN LQMPGPAAMR LAGGGTAHQQ PSGGAHQMKE ET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-33758962877Probable WRKY transcription factor 4
2lex_A6e-33758962877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.582850.0leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191910.0
Expression AtlasQ7XAA5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55164.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55164
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418520.0AY341852.1 Oryza sativa (japonica cultivar-group) WRKY11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ7XAA50.0Q7XAA5_ORYSJ; Os03g0758900 protein
STRINGLOC_Os03g55164.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP796922
MonocotsOGMP28753236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.12e-35WRKY DNA-binding protein 4